DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est10 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_001246962.1 Gene:alpha-Est10 / 40896 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:334 Identity:75/334 - (22%)
Similarity:130/334 - (38%) Gaps:99/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LNVYVK---DLQPDKLRPVMVWIYGGGYQVGEASRDMYSPDFFMSKDVVIVTVAYRLGALGFLSL 191
            |::|..   :|..:...||:|::|||.:  |...|.:|.        ::.:.:|..|.|    |:
Zfish   102 LDLYYSPRLELSDESPVPVVVFVYGGAW--GSGDRSIYC--------LLALQMAKELNA----SV 152

  Fly   192 DDPQLNV--PGNA--GLKDQIMALRWVQQNIEAFGGDSNNITLFGESAGGASTHFLALSPQTEGL 252
            ..|..::  .||.  .::|...:|.||:|...||..|.:||.|.|.|||   .|..||:      
Zfish   153 ICPDYSIYPKGNVLNMVQDISDSLLWVRQKGHAFSLDQDNIILIGHSAG---AHLCALT------ 208

  Fly   253 IHKAIVMSGSVLCPWTQPPRNNWAYRLAQKLGYTGDNKDKAIFEFLRSMSGGEIVKATATVLSND 317
               ::.::.:|                 ::| :...||.|.:...::.:.|   :....:::  |
Zfish   209 ---SLFLASNV-----------------EEL-FIETNKQKDLVTAIKGIIG---LSGVYSIM--D 247

  Fly   318 EKHHRILFAFGPVVEPYTTEHTVV-------AKQPHEL---MQNSWSHRIPMM--FGGTSFEGLL 370
            ..:|..:.|    ||..:|.|..:       ...|..|   |:.....|:|.|  |.||:  .::
Zfish   248 HYNHEKVRA----VEYVSTMHKAMDGVENFDYYSPTSLLKKMKEDQLKRVPPMALFHGTN--DII 306

  Fly   371 FYPEVSRRPATLDEVGNCKNLLPSDLGLNLDPKLRENYGLQLKKAYFGDEPCNQANMMKFLELCS 435
            ...|.|.|.:.|      ...|...:.|.|.||:                  |..:|:..| :..
Zfish   307 VPVESSVRFSEL------LTSLSIRMSLYLIPKM------------------NHTDMVTDL-MAP 346

  Fly   436 YREFWHPIY 444
            .|.|:|.:|
Zfish   347 DRHFYHTVY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..542 CDD:278561 75/334 (22%)
Aes <132..>279 CDD:223730 37/153 (24%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 68/312 (22%)
Abhydrolase 121..>210 CDD:304388 32/114 (28%)
Abhydrolase 167..336 CDD:304388 49/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.