DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est10 and NLGN3

DIOPT Version :9

Sequence 1:NP_001246962.1 Gene:alpha-Est10 / 40896 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_851820.1 Gene:NLGN3 / 54413 HGNCID:14289 Length:848 Species:Homo sapiens


Alignment Length:633 Identity:167/633 - (26%)
Similarity:239/633 - (37%) Gaps:176/633 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IKTKSGPVRGVK---RNTIWG--GSYFSFEKIPFAKPPVGDLRFKAPEAVEPWDQELDCTS-PAD 109
            :.|..|.:||.:   .:.|.|  ..|..   :|:|.||:|:.||..||....|....:.|. |..
Human    44 VNTHFGKLRGARVPLPSEILGPVDQYLG---VPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPV 105

  Fly   110 KPLQTH---------MFFRK---------YAGSEDCLYLNVYV---------------------- 134
            .|...|         ::|..         ...:||||||||||                      
Human   106 CPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICR 170

  Fly   135 ---------------------KDLQPDKLRPVMVWIYGGGYQVGEASRDMYSPDFFMS-KDVVIV 177
                                 :|::....:||||:|:||.|.  |.:.:|.......| .:|:::
Human   171 KGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYM--EGTGNMIDGSILASYGNVIVI 233

  Fly   178 TVAYRLGALGFLSLDDPQLNVPGNAGLKDQIMALRWVQQNIEAFGGDSNNITLFGESAGGASTHF 242
            |:.||:|.|||||..|..  ..||.||.|||.|||||.:||..||||...||:||...|.:....
Human   234 TLNYRVGVLGFLSTGDQA--AKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSL 296

  Fly   243 LALSPQTEGLIHKAIVMSGSVLCPWT---QPPRNNWAYRLAQKLGYTG-DNKDKAIFEFLRSMSG 303
            |.||..:|||..:||:.|||.|..|.   ||.:  :...||.|:|... |..|  :.:.||..|.
Human   297 LTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVK--YTSLLADKVGCNVLDTVD--MVDCLRQKSA 357

  Fly   304 GEIVKATATVLSNDEKHHRILFAFGPVVEPYTTEHTVVAKQPHELMQNSWSHRIPMMFGGTSFEG 368
            .|:|:       .|.:..|...|||||:     :..|:...|..||:........:|.|....||
Human   358 KELVE-------QDIQPARYHVAFGPVI-----DGDVIPDDPEILMEQGEFLNYDIMLGVNQGEG 410

  Fly   369 LLFY-----PEVSRRPATLDEVGNCKNLLPSDLGLNLDPKLRENYGLQLKKAY--FGDEPCNQAN 426
            |.|.     ||........|.  :..|.:.:..|.   |:.::.....:|..|  :.|....:..
Human   411 LKFVEGVVDPEDGVSGTDFDY--SVSNFVDNLYGY---PEGKDTLRETIKFMYTDWADRDNPETR 470

  Fly   427 MMKFLELCSYREFWHPIYRAALNRVRQSSAPTYLYRFDHDSKLCNAIRIVLCGHQMR----GVCH 487
            ....:.|.:..::..|....|....|..| |||.|.|.|.           |...|:    ...|
Human   471 RKTLVALFTDHQWVEPSVVTADLHARYGS-PTYFYAFYHH-----------CQSLMKPAWSDAAH 523

  Fly   488 GDDLCYIFHSMLSHQSAPDSPEHKVITGMVDV-------------------WTSFAAHGDPNCES 533
            ||::.|:|       ..|       :.|..|:                   ||:||..||||   
Human   524 GDEVPYVF-------GVP-------MVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPN--- 571

  Fly   534 IKSLKFAPIENVTNFKCLNIGDQFEVMALPELQKIEPVWNSFYAPNKL 581
                  .|:...|.| .....::||          |..|:.:...::|
Human   572 ------KPVPQDTKF-IHTKANRFE----------EVAWSKYNPRDQL 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..542 CDD:278561 159/592 (27%)
Aes <132..>279 CDD:223730 64/193 (33%)
NLGN3NP_851820.1 COesterase 36..624 CDD:278561 167/633 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..195 1/24 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.