DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est10 and Cesl1

DIOPT Version :9

Sequence 1:NP_001246962.1 Gene:alpha-Est10 / 40896 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_038953870.1 Gene:Cesl1 / 501232 RGDID:1565666 Length:596 Species:Rattus norvegicus


Alignment Length:530 Identity:158/530 - (29%)
Similarity:229/530 - (43%) Gaps:95/530 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIKTKSGPVRGVKRNTIWG--GSYFSFEKIPFAKPPVGDLRFKAPEAVEPWDQELD-------CT 105
            |:.|..|.|.| |..::.|  .|...|..:||||||:|.|||..|:..|||....:       |:
  Rat    60 VVDTMKGKVLG-KYASLEGVTQSVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCS 123

  Fly   106 SPADK-----------PLQTHMFFRKYAGSEDCLYLNVYV-KDLQPDKLRPVMVWIYGGGYQVGE 158
            ..|.|           ..:.|:.|     ||||||||:|. .|...|...||||||:|||...|.
  Rat   124 QDATKGQRMNDLLTNRKEKVHLQF-----SEDCLYLNIYTPADFTKDSRMPVMVWIHGGGLTQGG 183

  Fly   159 ASRDMYSPDFFMS-KDVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLKDQIMALRWVQQNIEAFG 222
            ||  .|......: ::||:|.:.||||..||.|..|....  ||.|..||:.||.|||.||..||
  Rat   184 AS--TYDGQVLSAYENVVVVAIQYRLGIWGFFSTGDEHSR--GNWGHLDQVAALHWVQDNIANFG 244

  Fly   223 GDSNNITLFGESAGGASTHFLALSPQTEGLIHKAIVMSGSVLCP--WTQPPRNNWAYRLAQKLGY 285
            ||..::|:|||||||.|...|.|||.::.|.|:||..||.||..  :|:..|.. |.::|...|.
  Rat   245 GDPGSVTIFGESAGGFSVSVLVLSPLSKNLYHRAISESGVVLITELFTKDVRPA-AKQIADMAGC 308

  Fly   286 TGDN--------KDKAIFEFLRSMSGGEIVKATATVLSNDEKHHRILFAFGPVVEPYTTEHTVVA 342
            ....        :.|...|.|..|....::|.::. ....|.:|.:......||.|         
  Rat   309 KTTTSAIIVHCLRQKTEEELLEIMEKMNLIKLSSQ-RDTKESYHFLSTVIDDVVLP--------- 363

  Fly   343 KQPHELMQNSWSHRIPMMFGGTSFEGLLFYPEVSRRPATLDEVGNCKNLLPSDLGLN------LD 401
            |.|.|::.....:.:|.:.|....|.....|.:.|             .:|.|:.|:      |.
  Rat   364 KDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMR-------------FVPPDVKLDKKMAIMLL 415

  Fly   402 PKLRENYGL-------QLKKAYFG-DEPCN-QANMMKFLELCSYREFWHPIYRAALNRVRQSSAP 457
            .|....||:       .::|...| |:|.. :..::.|:   ....|..|....:.:. |.:.||
  Rat   416 EKFASIYGIPEDIIPVAIEKYRKGSDDPIKIRDGILAFI---GDALFCIPSVMVSRDH-RDAGAP 476

  Fly   458 TYLYRFDHDSKLCNAIRIVLCGHQMRGVC--HGDDLCYIFHSMLSHQSAPDSPEHKVITGMVDVW 520
            ||:|.:.:.....:..|       .:.|.  |.||:..:|.:.:....|.:. |.|:...::..|
  Rat   477 TYVYEYQYYPSFSSPQR-------PKDVVGDHADDVYSVFGAPILRDGASEE-EIKLSKMVMKFW 533

  Fly   521 TSFAAHGDPN 530
            .:||.:|:||
  Rat   534 ANFARNGNPN 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..542 CDD:278561 158/530 (30%)
Aes <132..>279 CDD:223730 67/150 (45%)
Cesl1XP_038953870.1 COesterase 57..580 CDD:395084 158/530 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.