DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est10 and Aadacl4fm1

DIOPT Version :10

Sequence 1:NP_001246962.1 Gene:alpha-Est10 / 40896 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_941064.2 Gene:Aadacl4fm1 / 381572 MGIID:2685880 Length:407 Species:Mus musculus


Alignment Length:164 Identity:40/164 - (24%)
Similarity:72/164 - (43%) Gaps:43/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 WDQELD----CTSPADKPLQTHMFFRKYAGSEDCLYLNVYVKDLQ--------------PDKLRP 144
            |...|:    |:.|     |...|.:....|::  ...|:||||:              ..|.|.
Mouse    56 WGHILEKMNICSMP-----QFFCFLQDSLSSKE--NHGVFVKDLRFGTIPVRLFRPKAASSKPRR 113

  Fly   145 VMVWIYGGGYQVG--EASRDMYSPDFFMSK--DVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLK 205
            .:::.:|||..:|  ::..::.:   |:::  |.|:|:|.||  .|.:  ...|.|       ..
Mouse   114 GILFFHGGGAMIGSLDSHHNLCT---FLARETDSVLVSVGYR--KLPY--YHHPSL-------YH 164

  Fly   206 DQIMALRWVQQNIEAFGGDSNNITLFGESAGGAS 239
            |.|.|.....::::|:|.|.:.:.:.|||.|||:
Mouse   165 DCINASIHFLKSLKAYGIDPSRVVICGESIGGAA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..533 CDD:395084 40/164 (24%)
Aadacl4fm1NP_941064.2 alpha/beta hydrolases 115..380 CDD:473884 26/98 (27%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 0/1 (0%)

Return to query results.
Submit another query.