DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est10 and Jhedup

DIOPT Version :9

Sequence 1:NP_001246962.1 Gene:alpha-Est10 / 40896 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster


Alignment Length:563 Identity:172/563 - (30%)
Similarity:256/563 - (45%) Gaps:72/563 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GPVRGVKRNTIWGGSYFSFEKIPFAKPPVGDLRFKAPEAVEPWDQELDCTSPADKPLQTHMFFRK 120
            |.:||........|.:.:|..||||:||||.||.|.|...|||:..||..:..|..:|...|.::
  Fly    28 GCMRGTLMPGYQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSCIQRSYFAKE 92

  Fly   121 YA--GSEDCLYLNVY-VKDLQPDKLRPVMVWIYGGGYQVGEASRDMYSPDFFM-SKDVVIVTVAY 181
            :.  |.||||||||| .|:...||| ||||:|:|||:..|.|......|::.| :..||:||:.|
  Fly    93 WGLMGVEDCLYLNVYRPKNRAEDKL-PVMVYIHGGGFFSGSAHPMASGPEYLMDTNKVVMVTMNY 156

  Fly   182 RLGALGFLSLDDPQLNVPGNAGLKDQIMALRWVQQNIEAFGGDSNNITLFGESAGGASTHFLALS 246
            |||..||||..|.  ::|||.|.|||.:||:|:|::|..||||...:|:.|.||||.|.|...:|
  Fly   157 RLGPFGFLSTGDE--HMPGNFGFKDQRLALQWIQKHIATFGGDPKKVTVLGHSAGGISAHLHMIS 219

  Fly   247 PQTEGLIHKAIVMSGSVLC--------PWTQPPRNNWAYRLAQKLGYTGDNKDKA-------IFE 296
            |.::||...::.::|::..        |.:|      |.||.::|..     |:|       :.|
  Fly   220 PNSKGLFQNSMSLTGTMFLSAMKILKDPLSQ------ARRLGKELAI-----DQAESLSSQDLAE 273

  Fly   297 FLRSMSGGEIVKATATVLSNDEKHHRILFAFGPVVE-----PYTTEHTVVAKQPHELMQNSWSHR 356
            .||::...:::.:..::...|...|....   ||:|     .:..|..:.|.:...:.|..|...
  Fly   274 ALRNVCPKKLLVSVDSLKVWDNMPHLTTL---PVLEAPSPDAFLVEDPLDAHRAGRINQMPWILS 335

  Fly   357 IPMMFGGTSFEGLLFYPEVSRRPATLDEVGNCKNLLP-SDLGLNLDPKLRENYGLQLKKAY-FGD 419
            :....|    ||.||.......|....|..  :|.|. ..|.|||..........::..|| |..
  Fly   336 LSSRAG----EGSLFIMRAFINPKLRAEFN--ENFLEHMALLLNLPEGTPVQMVSEILDAYDFKG 394

  Fly   420 EPCNQANMMKFLELCSYREFWHPIYRAALNRVRQSSA---PTYLYRFDHDSKLCNAIRIVLCG-- 479
            :..|...|:|..|:.....|::|||....:.|..::.   |.::|.|:...  .|:|.....|  
  Fly   395 DSLNNDTMLKLAEISGDFNFYYPIYETISSYVTYANLEENPLFIYIFEFAG--LNSITKFFAGTT 457

  Fly   480 -HQMRGVCHGDDLCYIFHSMLSHQSAP-DSPEHKVITGMVDVWTSFAAHGDPNCESIKSLKFAPI 542
             ....|..|.||..:.....:|....| ||.:.|||..|..:.|.||..|..:.|||..:.....
  Fly   458 DDYGLGAVHMDDGLHTIRIPVSFDDFPKDSEDAKVIQRMSSLMTDFAKTGVFHEESICKVSDFKE 522

  Fly   543 ENVTNFKCLNIGDQFEVMALPELQKIE--------PVWNSFYA 577
            :.:.|:  |:.|...|    ..|:.|.        |:|...:|
  Fly   523 QGMCNY--LHFGGNKE----KYLEDIRNSITLTAFPIWKKLFA 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..542 CDD:278561 163/518 (31%)
Aes <132..>279 CDD:223730 63/156 (40%)
JhedupNP_611085.2 COesterase 31..508 CDD:278561 158/501 (32%)
Aes <106..>210 CDD:223730 51/106 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440401
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
76.740

Return to query results.
Submit another query.