DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wa-cup and Odad4

DIOPT Version :9

Sequence 1:NP_649721.2 Gene:wa-cup / 40892 FlyBaseID:FBgn0037502 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001100519.1 Gene:Odad4 / 303534 RGDID:1311859 Length:645 Species:Rattus norvegicus


Alignment Length:571 Identity:119/571 - (20%)
Similarity:219/571 - (38%) Gaps:118/571 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YANGLRYFNSALDLNPFNERALMRRSQLKRSMGLASEALKDCSRAEDLLMSRKPPVTNPNVSLEV 116
            ::..::.|::||.|...::..|:.||:....||...::|:|   ||..|  :..|.....: |:.
  Rat    31 FSKAIQSFSNALHLQSGDKNCLVARSKCYLKMGDLEKSLED---AEASL--QNDPTFCKGI-LQK 89

  Fly   117 CDALYESNRLEDSKINLHCHLKRFSSGQRGPVLDRLNVLNENFHDTLSDDTTMSV-----QRLIN 176
            .:.||.....|.:.:..|...|                        |..|....|     |..||
  Rat    90 AETLYTMGDFEFALVFYHRGYK------------------------LRPDREFKVGIQKAQEAIN 130

  Fly   177 RMMASLAKEPKDIK--DTCDVVSIMENEET-----------HL--SPLEMARRKRHFKIYN--QT 224
            ..:.|    |..||  :..|:..:.:..|:           ||  |.....:||...|...  :.
  Rat   131 NSVGS----PSSIKLENKGDLSFLSKQAESKKAQQKHPPVKHLLSSTKHEIKRKGSLKSEKTIRQ 191

  Fly   225 YLNKCWVDVAFLKTLRDDPNVLPKHCKKSSEYLGKLMAS--NYKAERTLTKTLHTRSPMYALHQQ 287
            .|.:.:||..:|:.|..|.::: |...||...:.:|:.:  ||         |.|||..:  .||
  Rat   192 LLGELYVDKEYLEKLLLDEDLI-KGTIKSGLTVEELIMTGINY---------LDTRSNFW--RQQ 244

  Fly   288 KYPNEAFYNKHREENLYRIQY---------QTRRNMFKILRSIRLLIRVGELNKLTTFIEEVMGD 343
            |    ..|.:.|:..|.:.::         ||...:.|.|..|.:|:..|.........|:|:  
  Rat   245 K----PIYARERDRKLMQEKWLRDRKRSPSQTAHYILKSLEDIDMLLTSGSAEGSLQKAEKVL-- 303

  Fly   344 YVTIKTNRVMPW-------KFEFTNEVYNYLGLARINEYKIPSNMTVLQGKQRLLTLFRLPLSNS 401
                  .:|:.|       |.|....:|:.:|.|:|   ::...:..||..::     .|.::..
  Rat   304 ------KKVLEWNQDEVPNKDELVGNLYSCIGNAQI---ELGQMVAALQSHRK-----DLEIAKE 354

  Fly   402 LDMKKSKTKRTSALNITRSATTDPKAEHFKKQVVRLENRMRFAEYHIERAYLLHELAQEHLNCNS 466
            .|:..:|::...  ||.|   ...:...|::.:...|.::..|:..:|:.:|.||:.:.:|..:.
  Rat   355 HDLPDAKSRALD--NIGR---VFARVGKFQQAIDTWEEKIPLAKTTLEKTWLFHEIGRCYLELDQ 414

  Fly   467 FDGACSMARMALEEAIKCKSVIWSFLSLMVICKAHAILGKIEREKEILAEAFELAKKMKNLD--- 528
            ...|.|....:.:.|.:...:.|...:.:::.:|...|...|.......:|.|.||.:.|.:   
  Rat   415 AWQAQSYGEKSQQYAEEEGDLEWQLNASVLVAQAQVKLRDFESAVNNFEKALERAKLVHNNEAQQ 479

  Fly   529 -LCLFIDICIKVNAEEMEMK--RMVTTDLTAKRQKFGSKMFQSNDQVNEDR 576
             :...:|...|...||::..  |.:..: .|:||...|:|..|.....|.|
  Rat   480 AIISALDDANKGIIEELKKTNYREILRE-KAERQDISSQMEFSGASEKETR 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wa-cupNP_649721.2 TPR_11 39..99 CDD:290150 13/46 (28%)
TPR repeat 39..64 CDD:276809 2/11 (18%)
TPR repeat 69..99 CDD:276809 9/29 (31%)
Odad4NP_001100519.1 TPR_11 18..80 CDD:290150 14/53 (26%)
TPR repeat 18..43 CDD:276809 2/11 (18%)
TPR repeat 48..78 CDD:276809 10/34 (29%)
TPR_11 51..114 CDD:290150 18/92 (20%)
TPR repeat 83..111 CDD:276809 5/28 (18%)
TPR repeat 313..351 CDD:276809 9/45 (20%)
TPR_12 318..387 CDD:290160 14/81 (17%)
TPR repeat 362..387 CDD:276809 4/29 (14%)
TPR_12 363..431 CDD:290160 14/72 (19%)
TPR_12 400..470 CDD:290160 13/69 (19%)
TPR repeat 433..467 CDD:276809 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5389
OMA 1 1.010 - - QHG51895
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.