DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir84a and clumsy

DIOPT Version :9

Sequence 1:NP_649720.2 Gene:Ir84a / 40891 FlyBaseID:FBgn0037501 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001036373.1 Gene:clumsy / 35394 FlyBaseID:FBgn0026255 Length:1002 Species:Drosophila melanogaster


Alignment Length:493 Identity:116/493 - (23%)
Similarity:184/493 - (37%) Gaps:130/493 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 QKFGNFKNTWVIRRRNFLNVTLIGSTVLTEKPPGFGDMEYLADDKQLQQLDPMQRKTYQLFQLVE 268
            ||..|  .|:::..|       :|:..||.:.|..|  |.|..:.:.:..      :..|...:.
  Fly   410 QKLSN--KTFIVSSR-------LGAPFLTLREPQEG--EILTGNSRYEGY------SIDLINEIA 457

  Fly   269 RMFNLSLAISLT--DKWGELLD-NGSWSGVMGQVTSREADFAVCPIRFVLDRQPYVQYSAVLHTQ 330
            :|.|......::  .|:|.|.. ..:|.|::.|:....||..:|.:.....|:..|.::....|.
  Fly   458 KMLNFKFEFRMSPDGKYGALNKVTQTWDGIVRQLIDGNADLGICDLTMTSSRRQAVDFTPPFMTL 522

  Fly   331 NIHFLFRHPRRSHIKNI-FFEPLSNQVWWCVLALVTGSTI----LLLFHVRLERML--------- 381
            .|..||..|........ |..|.|..||     :..||..    ||||  .|.||.         
  Fly   523 GISILFSKPPTPPTDLFSFLSPFSLDVW-----IYMGSAYLFISLLLF--ALARMAPDDWENPHP 580

  Fly   382 ----SNMENRFSFVWFTMLETYLQ----QGPANEIF-RLFSTRLLISLSCIFSFMLMQFY----G 433
                ..:||    :|..|..|:|.    .|...:|. :..||||:..:...|:.|::..|    .
  Fly   581 CKEPEEVEN----IWSIMNTTWLSIGSLMGQGCDILPKAASTRLVTGMWWFFALMMLNSYTANLA 641

  Fly   434 AFIVGSLLSESARSIVNLQA-----------------LYDSNLA------IGMENISYNFPIFTN 475
            ||:..|..:.|..|..:|.|                 ..|||.:      ..||:.|.:  :||.
  Fly   642 AFLTNSRQANSINSAEDLAAQSKIKYGAMAGGSTMGFFRDSNFSTYQKMWTAMESASPS--VFTK 704

  Fly   476 TSNQLVRDVYVKKICKSGEHNIMSLQQGAERIIQGRFAFHTAIDRMYRLLLE---LQMDEAEFCD 537
            |::                       :|.||:.:|:        .:|..|:|   |:.:....||
  Fly   705 TND-----------------------EGVERVQKGK--------NLYAFLMESTTLEYNVERKCD 738

  Fly   538 LQEVMFNLPYDS-GSVMPKGSPWREHLAHALLHFRATGLLQYNDKKW---MVRRPDCSLFKTSQ- 597
            |.::...|.|.| |..||..||:|:.::.|:|.....|.|....:||   |....:|.  |:.: 
  Fly   739 LVQIGGWLDYKSYGIAMPFNSPYRKQISAAVLKLGELGQLAELKRKWWKEMHGGGNCE--KSDED 801

  Fly   598 ----AEVDLEHFAPALFALALAMVASALVFLLELFLHW 631
                .|:.||:.......|.|.:: ||:|.....|| |
  Fly   802 GGDTPELGLENVGGVFLVLGLGLL-SAMVLGCTEFL-W 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir84aNP_649720.2 nt_trans <54..>112 CDD:294020
Periplasmic_Binding_Protein_Type_2 222..583 CDD:304360 95/417 (23%)
Lig_chan 355..602 CDD:278489 72/307 (23%)
clumsyNP_001036373.1 PBP1_iGluR_Kainate 26..396 CDD:107377
ANF_receptor 39..379 CDD:279440
PBP2_iGluR_Kainate 414..787 CDD:270432 100/433 (23%)
Lig_chan 548..812 CDD:278489 73/309 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.