DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir84a and GluRIIC

DIOPT Version :9

Sequence 1:NP_649720.2 Gene:Ir84a / 40891 FlyBaseID:FBgn0037501 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_608557.4 Gene:GluRIIC / 33275 FlyBaseID:FBgn0046113 Length:940 Species:Drosophila melanogaster


Alignment Length:449 Identity:83/449 - (18%)
Similarity:168/449 - (37%) Gaps:90/449 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PPGFGDMEYLADDKQLQQLDPMQRKTYQ-----LFQLVERMFNLS-LAISLTD-KWGEL-LDNGS 291
            ||      |.:.::..::|:......||     |...:.|..... :.:.:.| ::|:| .:...
  Fly   431 PP------YFSYNETARELNLTGNALYQGYAVDLIDAIARHVGFEYVFVPVADQQYGKLDKETKQ 489

  Fly   292 WSGVMGQVTSREADFAVCPIRFVLDRQPYVQYSAVLHTQNIHFL-FRHPRRSHIKNIFFEPLSNQ 355
            |:|::|::.:.:|...:|.:.....|:..|.::.......:..| ::.|......:.:..|...:
  Fly   490 WNGIIGEIINNDAHMGICDLTITQARKTAVDFTVPFMQLGVSILAYKSPHVEKTLDAYLAPFGGE 554

  Fly   356 VWWCVLALVTGSTILLLFHVRLERM--------------LSNMENRFSFVWFTMLETYLQQGPAN 406
            ||..:|..|...|.|.....|:.:|              |.|.....:..|.|:..  :.....:
  Fly   555 VWIWILISVFVMTFLKTIVARISKMDWENPHPCNRDPEVLENQWRIHNTGWLTVAS--IMTAGCD 617

  Fly   407 EIFRLFSTRLLISLSCIFSFMLMQFY----GAFIVGSLLSESARSIVNLQA-------------- 453
            .:.|....|:..:...||:.::...|    .||:..|.:..|..::.:|.|              
  Fly   618 ILPRSPQVRMFEATWWIFAIIIANSYTANLAAFLTSSKMEGSIANLKDLSAQKKVKFGTIYGGST 682

  Fly   454 ---LYDSNLAIGMENISYNFPIFTNTSNQLVRDVYVKKICKSGEHNIMSLQQGAERIIQGRFAFH 515
               |.|||..:        :.:..|..|......|.|       .|:    :|.:|:.:.|    
  Fly   683 YNLLADSNETV--------YRLAFNLMNNDDPSAYTK-------DNL----EGVDRVRKNR---- 724

  Fly   516 TAIDRMYRLLLE---LQMDEAEFCDLQEV--MFNLPYDSGSVMPKGSPWREHLAHALLHFRATGL 575
                ..|..|:|   |:....:.|||:.|  .|...:.:.:| |.|:.:|.:|:.|:|.....|.
  Fly   725 ----GDYMFLMETTTLEYHREQNCDLRSVGEKFGEKHYAIAV-PFGAEYRSNLSVAILKLSERGE 784

  Fly   576 LQYNDKKWMVRRPDCSLFK----TSQAEVDLEHFAPALFALALAMVASALVFLLELFLH 630
            |....:||. :.|:.|.|:    .:..::..|......:.|...::.:.|:.:.|..::
  Fly   785 LYDLKQKWW-KNPNASCFEEPDPDATPDMTFEELRGIFYTLYAGILIAFLIGITEFLVY 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir84aNP_649720.2 nt_trans <54..>112 CDD:294020
Periplasmic_Binding_Protein_Type_2 222..583 CDD:304360 74/396 (19%)
Lig_chan 355..602 CDD:278489 58/290 (20%)
GluRIICNP_608557.4 PBP1_iGluR_Kainate 26..404 CDD:107377
Periplasmic_Binding_Protein_Type_1 <279..363 CDD:299141
PBP2_iGluR_Kainate 423..794 CDD:270432 76/399 (19%)
Lig_chan 554..828 CDD:278489 60/304 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.