DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir84a and glr-4

DIOPT Version :9

Sequence 1:NP_649720.2 Gene:Ir84a / 40891 FlyBaseID:FBgn0037501 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001254126.1 Gene:glr-4 / 174258 WormBaseID:WBGene00001615 Length:951 Species:Caenorhabditis elegans


Alignment Length:486 Identity:108/486 - (22%)
Similarity:193/486 - (39%) Gaps:93/486 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RMGIDADITVALRGPDNASMLFYDVYRISRQANTPLIIEKKGLWTHSGGYQKFGNFKNTWVIRRR 218
            |..:..|:.....| :...::::.|.||:.|      ..|.|.|:...|:.....:.|.|..   
 Worm   342 RNQLTGDVQFKSNG-ERDDIMYHGVGRINSQ------FVKLGNWSEKRGWNFDSRYANRWEF--- 396

  Fly   219 NFLNVTLIGSTVLTEKPPGFGDMEYLADDKQLQQLDPMQRKT----YQLF--QLVERM-----FN 272
                          :..|...|:|.|.....:...:|...||    |:.|  .|:..|     ||
 Worm   397 --------------DIDPDSEDLEGLHLRVVVYLEEPFVIKTGENQYEGFCIDLLNEMTQVLKFN 447

  Fly   273 LSLAISLTDKWGELLDNGSWSGVMGQVTSREADFAVCPIRFVLDRQPYVQYSAVLHTQNIHFLFR 337
            .::.......:|...::|.|:|::|.:...|||.::..:.....|...|.::.......|..|..
 Worm   448 YTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLA 512

  Fly   338 HPRRSHIKN---IFFEPLSNQVWWCVLALVTGSTILLLFHV----------RLERM-------LS 382
            .......|.   .|.||||..||  :..|::...:....|:          .|||:       :.
 Worm   513 RTSEETDKGSLWTFLEPLSLTVW--ISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIK 575

  Fly   383 NMENRFSFV---WFTMLETYLQQGPANEIFRLFSTRLLISLSCIFSFMLMQFY----GAFIVGSL 440
            |.:|:|:.:   |||| .:.:||| ::.|.|..:|||:..:..:|:.:::..|    .||:....
 Worm   576 NQKNQFTVLNSFWFTM-GSLMQQG-SDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVER 638

  Fly   441 LS---ESARSIVNLQALYDSNLAIGMENISYNFPIFTNTSNQLVRDVYVKKICKSGEHNIM--SL 500
            :|   ||.:.:.|.|     .:..|:.........|..:...:...::  .:.:|....:.  |.
 Worm   639 MSTPIESTQDLANQQ-----KIRYGVLKSGSTMDFFRESKIPMYERMW--SVMESSSPGVFVNSS 696

  Fly   501 QQGAERIIQGRFAFHTAIDRMYRLLLELQMDEAEFCDLQEVMFNLPYDS---GSVMPKGSPWREH 562
            ::|..|:..|.:|:     .|...:||..::..  |:||.:...|  ||   |..:|||||.|:.
 Worm   697 REGIARVKSGGYAY-----MMESSMLEYYLERD--CELQSIGGLL--DSKGYGIALPKGSPLRDI 752

  Fly   563 LAHALLHFRATGLLQ-YNDKKWMVRR--PDC 590
            |:..:|..:...:|: ..:|.|..||  |.|
 Worm   753 LSRTVLQLQERTILEALKNKWWRDRREGPSC 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir84aNP_649720.2 nt_trans <54..>112 CDD:294020
Periplasmic_Binding_Protein_Type_2 222..583 CDD:304360 90/407 (22%)
Lig_chan 355..602 CDD:278489 64/271 (24%)
glr-4NP_001254126.1 PBP1_iGluR_Kainate 30..385 CDD:107377 11/49 (22%)
ANF_receptor 45..365 CDD:279440 3/23 (13%)
Periplasmic_Binding_Protein_Type_2 410..775 CDD:304360 86/384 (22%)
Lig_chan 533..810 CDD:278489 64/271 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.