DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir84a and Grin3b

DIOPT Version :9

Sequence 1:NP_649720.2 Gene:Ir84a / 40891 FlyBaseID:FBgn0037501 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:418 Identity:85/418 - (20%)
Similarity:164/418 - (39%) Gaps:57/418 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LVERM-----FNLSLAISLTDKWGELLDNGSWSGVMGQVTSREADFAVCPIRFVLDRQPYVQYSA 325
            |:||:     |:..|.|....|:|.|.| |.|:|::|.:.:..|..||........|...|.:::
  Rat   483 LLERLAEDLAFDFELYIVGDGKYGALRD-GRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTS 546

  Fly   326 VLHTQNIHFLFRHPRRSHIKNIFFEPLSNQVWWCVL-ALVTGSTILLLFHVRLERMLS----NME 385
            ...:.::..:.|....:.....|..||...:|..|. ||...:..|.|:..|....|:    |..
  Rat   547 PFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRG 611

  Fly   386 NRFSF-----VWFTML--ETYLQQGPANEIFRLFSTRLLISLSCIFSFMLMQFYGAFIVGSLLSE 443
            ..||:     :.:.:|  .|...:.|     :..:.|.|::|..||..:::..|.|.:...::.:
  Rat   612 TVFSYSSALNLCYAILFGRTVSSKTP-----KCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGD 671

  Fly   444 SARSIVNLQALYDSNLAIGMENISYNFPIFTNTSNQLVRDVYVKKICKSGEHNIMSLQQGAERII 508
              ::...|..::|..|....:...:. .::.:::...::..:.:.......|:..:...|...:.
  Rat   672 --KTFEELSGIHDPKLHHPSQGFRFG-TVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLT 733

  Fly   509 QGRFAFHTAIDRMYRLLLELQMDEAEFCDLQEVMFNLPY---DSGSVMPKGSPWREHLAHALLHF 570
            ......:..|  |.:.||:.::.....|.|..|  ..|:   ..|..:|:.||...:|:..:..:
  Rat   734 SDPPKLNAFI--MDKSLLDYEVSIDADCKLLTV--GKPFAIEGYGIGLPQNSPLTSNLSEFISRY 794

  Fly   571 RATGLLQYNDKKWMVRRPDCS--LFK-TSQAEVDLEHFAPALFALALAMVASAL-------VFL- 624
            :::|.:.....||....| |.  :|. |...::.:.||: .||.|....:.|||       ||. 
  Rat   795 KSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMGVYHFS-GLFVLLCLGLGSALLTSLGEHVFYR 857

  Fly   625 -----------LELFLHWLPDFRRRLGT 641
                       |:.:||......|.|.|
  Rat   858 LVLPRIRRGNKLQYWLHTSQKIHRALNT 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir84aNP_649720.2 nt_trans <54..>112 CDD:294020
Periplasmic_Binding_Protein_Type_2 222..583 CDD:304360 63/336 (19%)
Lig_chan 355..602 CDD:278489 46/264 (17%)
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438 64/337 (19%)
Lig_chan 576..842 CDD:278489 51/279 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910 2/4 (50%)
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.