DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MstProx and AT1G72910

DIOPT Version :10

Sequence 1:NP_649719.2 Gene:MstProx / 40890 FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_177434.1 Gene:AT1G72910 / 843622 AraportID:AT1G72910 Length:380 Species:Arabidopsis thaliana


Alignment Length:74 Identity:17/74 - (22%)
Similarity:38/74 - (51%) Gaps:4/74 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 RFDAFLAFTHKDEALLEEFVDRLERGRPRFQLCFYL--RDWLAGESIPDCIGQSIKDSRRIIVLM 885
            ::|.||:|...|..  :.|:..|.:...|..:..:.  ::...|:.|...:.::|:.||..:|::
plant     8 KYDVFLSFRGHDTR--QNFISFLYKELVRRSIRTFKDDKELENGQRISSELKRTIEVSRFAVVVV 70

  Fly   886 TENFMNSTW 894
            :|.:..|:|
plant    71 SETYAASSW 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MstProxNP_649719.2 PRK15370 <315..>398 CDD:185268
leucine-rich repeat 325..345 CDD:275378
leucine-rich repeat 346..367 CDD:275378
TIR 823..960 CDD:214587 17/74 (23%)
AT1G72910NP_177434.1 PLN03210 1..>327 CDD:215633 17/74 (23%)
TIR 9..171 CDD:396246 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.