DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MstProx and lgi1b

DIOPT Version :9

Sequence 1:NP_649719.2 Gene:MstProx / 40890 FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_001122241.1 Gene:lgi1b / 654829 ZFINID:ZDB-GENE-060217-1 Length:543 Species:Danio rerio


Alignment Length:185 Identity:42/185 - (22%)
Similarity:70/185 - (37%) Gaps:58/185 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 NTIMSIYKYMEWLHRKLIFVNREYDLFYIRQMAAPCPHKCECCYSRDSLILKIDCRN--KFVYNF 544
            |..:..|.::.|:...|:|....      |.....||..|.|  ::|:.:    |.|  ...::|
Zfish     5 NRSIRAYTFLLWVAAVLLFAESR------RGKQPRCPSGCTC--TKDNAL----CENVRSVPHSF 57

  Fly   545 -PDIVARN------SRLMGKQNMSSP-------------------------ME-LHLSKNNISNI 576
             ||:::.:      |.:.|...:.:|                         :| |.:..|.|.:|
Zfish    58 PPDVISLSFVKSGFSEIAGGSFLHTPSLQLLLFTANSFDLIDEDAFQGLPHLEYLFIENNKIESI 122

  Fly   577 TIAMLP------KELRFLDLRFNNLVTLDDKVLSYLKKNSIKTKLSGNPWNCDCK 625
            :    |      |.|..|.|.:|||.||...:...:...: |..|.||.::||||
Zfish   123 S----PHAFRGLKSLIHLSLAYNNLETLPRDIFKGMDALT-KVDLRGNLFSCDCK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MstProxNP_649719.2 leucine-rich repeat 325..345 CDD:275378
leucine-rich repeat 346..367 CDD:275378
leucine-rich repeat 563..583 CDD:275378 7/51 (14%)
leucine-rich repeat 585..610 CDD:275378 8/24 (33%)
leucine-rich repeat 611..622 CDD:275378 4/10 (40%)
TIR 823..960 CDD:214587
lgi1bNP_001122241.1 LRR_8 83..143 CDD:290566 12/63 (19%)
LRR_4 83..124 CDD:289563 6/44 (14%)
leucine-rich repeat 85..108 CDD:275378 0/22 (0%)
LRR_4 107..147 CDD:289563 14/43 (33%)
leucine-rich repeat 109..132 CDD:275378 6/26 (23%)
leucine-rich repeat 133..156 CDD:275378 8/22 (36%)
leucine-rich repeat 157..169 CDD:275378 4/12 (33%)
LRRCT 165..213 CDD:214507 5/8 (63%)
EPTP 217..258 CDD:281697
EPTP 263..304 CDD:281697
EPTP 309..355 CDD:281697
EPTP 358..400 CDD:281697
EPTP 405..447 CDD:281697
EPTP 450..491 CDD:281697
EPTP 496..536 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.