DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MstProx and Con

DIOPT Version :10

Sequence 1:NP_649719.2 Gene:MstProx / 40890 FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster


Alignment Length:152 Identity:32/152 - (21%)
Similarity:47/152 - (30%) Gaps:57/152 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLITMGDKKVKLQIWDTAGQERFRSVTTSYYRD-----ADALLLVYDIANRASFENCRNWLSQIK 117
            :|:.....|....:|..||.:.|......|..:     |.::|.::                   
  Fly   117 ELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIW------------------- 162

  Fly   118 EYGKEAVQVTLVGNKCDLPRAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAERMLKLKY 182
                 |.||.|:|       ||   ||.|:|                  ....||.||.:|....
  Fly   163 -----ATQVILMG-------AV---EGYRVA------------------GNGPLGEAEDLLYPGG 194

  Fly   183 GFVPGGEMADTISVADTKKPEI 204
            .|.|.|...|..:.|:.|..|:
  Fly   195 SFDPLGLATDPEAFAELKVKEL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MstProxNP_649719.2 PRK15370 <315..>398 CDD:185268
leucine-rich repeat 325..345 CDD:275378
leucine-rich repeat 346..367 CDD:275378
TIR 823..960 CDD:214587
ConNP_523930.3 LRR <157..459 CDD:443914 24/112 (21%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..232 CDD:275380 3/8 (38%)
leucine-rich repeat 233..256 CDD:275380
leucine-rich repeat 257..280 CDD:275380
leucine-rich repeat 281..304 CDD:275380
leucine-rich repeat 305..328 CDD:275380
leucine-rich repeat 329..352 CDD:275380
leucine-rich repeat 353..376 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.