DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MstProx and CG18095

DIOPT Version :9

Sequence 1:NP_649719.2 Gene:MstProx / 40890 FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster


Alignment Length:676 Identity:142/676 - (21%)
Similarity:230/676 - (34%) Gaps:268/676 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 KRMVLTNCTVRNLTFLRTLQKSLEHLELDIDNEVDLKYFTNFSSLKFMKVRNYIPNKNFTALICT 270
            |..:||:.|:.|.|        |.|:|..        :|..|..|..:::::             
  Fly    37 KTELLTSLTLSNCT--------LPHVENG--------FFVRFDHLLHLELQH------------- 72

  Fly   271 HKNCNFIRGINGLECPKLCQCLYIIDDLELNIDCSNLGLLQIPPLPIPSYGGVKLNFSNNSLSQL 335
                   .|::.|            ||..||      ||.::      .|    |:.|:|:||.|
  Fly    73 -------SGLSDL------------DDFSLN------GLTKL------QY----LSLSHNNLSSL 102

  Fly   336 PTMTLPGYKLVKRLDVSRNRLTNLSINHLP--AKLDYLDVSFNEIINMGNDVIKYLRTVPIFKQT 398
            .:.:......:..||:|.|.|:.||:....  .:|..||:.:|.|..:.||....|..:......
  Fly   103 RSWSSEPLGALTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLN 167

  Fly   399 GNQWTIHCDDKPLLNFFRHLKLIIRMKSAEMKPMFLHSLTELPKGFLKFLGKHFIWLGVRKQEYY 463
            ||| ..|.|.    :|||.                ||.|:.               |.::.....
  Fly   168 GNQ-LAHIDG----SFFRG----------------LHRLSS---------------LSLQHNRIE 196

  Fly   464 LINEEQLLQSMHRKLNNLNTIMSIYKYMEWLHR----KLIFVNREYDLFYIRQMAAPCPHKCECC 524
            .|..:....:.|  |.:|....::...:::|.:    :|:.:|..                    
  Fly   197 FIEMDSFESNTH--LRSLRLDQNLLSSLQFLSQRGLARLVHLNLS-------------------- 239

  Fly   525 YSRDSLILKIDCRNKFVY--NFP----DIVARNSRLMGKQNMS---SPMELHLSKNNISNI---- 576
               .:|:.|::   .||:  ||.    |:...|...:.|:.:|   |...|::|.|.:..|    
  Fly   240 ---SNLLQKLE---PFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDES 298

  Fly   577 ---TIAMLPKELRFLDLRFNNLVTLDDKVLSY--------LKKNSIKTKLSGNPWNCDCKSRSVL 630
               .||:|.     ||:.||.|.||.|.:..:        |..|.|:...|...:|         
  Fly   299 LDSLIALLQ-----LDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFN--------- 349

  Fly   631 SILRDHEPLEYDVTLKRCNISPTDCPDVCVCCLDNLTWPSFIVDCRGEGLLQMPSLSSRVTYVDL 695
               ::|        |:...:|.....|...  ||.|:                ||::....||||
  Fly   350 ---QNH--------LRYIKLSGNAISDAAF--LDRLS----------------PSVNRFTLYVDL 385

  Fly   696 RNNNLTALSQKNRSSIENRSLKLH-----LLDNPWSCS---CNDIEK----INF------MKSVS 742
            .:|.|.:|   |.||:      ||     |.||.|||:   .|.::|    :||      :.::|
  Fly   386 SSNRLKSL---NLSSL------LHFRYINLADNNWSCNWLVANLVQKLPNSVNFARPWTVINNLS 441

  Fly   743 SSIVDFTEIKCSNGEKLVSINQHIV----------------C-------------------PSDL 772
            .:..:...|.|..|    ..|:.|:                |                   |:|.
  Fly   442 ENTTNVEGIDCIEG----GTNRSIILLDVSGVPQPKSDNCDCVVAYDETNPSPPPLTWPKIPTDR 502

  Fly   773 FYYLALAI-SLVATIIALNFLIWFRQ 797
            |...::.| .|||..||.:.|.|.|:
  Fly   503 FDSRSVIIWMLVAIAIAFSGLRWLRR 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MstProxNP_649719.2 leucine-rich repeat 325..345 CDD:275378 6/19 (32%)
leucine-rich repeat 346..367 CDD:275378 7/22 (32%)
leucine-rich repeat 563..583 CDD:275378 7/26 (27%)
leucine-rich repeat 585..610 CDD:275378 9/32 (28%)
leucine-rich repeat 611..622 CDD:275378 2/10 (20%)
TIR 823..960 CDD:214587
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 10/38 (26%)
LRR_8 64..123 CDD:290566 20/106 (19%)
leucine-rich repeat 65..88 CDD:275380 9/60 (15%)
leucine-rich repeat 89..112 CDD:275380 7/32 (22%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_RI 115..384 CDD:238064 75/375 (20%)
LRR_8 135..195 CDD:290566 20/95 (21%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 9/43 (21%)
LRR_8 184..243 CDD:290566 9/98 (9%)
leucine-rich repeat 185..208 CDD:275380 3/37 (8%)
leucine-rich repeat 209..232 CDD:275380 3/22 (14%)
LRR_8 232..289 CDD:290566 15/82 (18%)
leucine-rich repeat 233..256 CDD:275380 7/48 (15%)
leucine-rich repeat 257..280 CDD:275380 4/22 (18%)
LRR_8 280..339 CDD:290566 18/63 (29%)
leucine-rich repeat 281..304 CDD:275380 4/22 (18%)
leucine-rich repeat 305..328 CDD:275380 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.