DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MstProx and lgi1a

DIOPT Version :9

Sequence 1:NP_649719.2 Gene:MstProx / 40890 FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster
Sequence 2:NP_955921.2 Gene:lgi1a / 323011 ZFINID:ZDB-GENE-030131-1731 Length:537 Species:Danio rerio


Alignment Length:152 Identity:38/152 - (25%)
Similarity:61/152 - (40%) Gaps:44/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 RQMAAPCPHKCECCYSRDSLILKIDCRN--KFVYNFP-DIVARNSRLMG-----KQNMSSPMELH 567
            |:.::.||..|.|  |:|:.:    |.|  ....:|| |:::.:....|     |::......||
Zfish    22 RRRSSRCPAPCTC--SKDNAL----CANTGAIPRSFPQDVISLSFVKSGFTEIPKESFIHTPALH 80

  Fly   568 L------SKNNISNITIAMLP-----------------------KELRFLDLRFNNLVTLDDKVL 603
            |      |.::|:......||                       |.|..|.|.:|||.||...:.
Zfish    81 LLLFTANSFDSINEDAFLGLPHLEYLFIENNQIKSISPFAFRGLKSLIHLSLAYNNLETLPKDLF 145

  Fly   604 SYLKKNSIKTKLSGNPWNCDCK 625
            ..::..: |..|.||.::||||
Zfish   146 KGMEALT-KVDLRGNLFSCDCK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MstProxNP_649719.2 leucine-rich repeat 325..345 CDD:275378
leucine-rich repeat 346..367 CDD:275378
leucine-rich repeat 563..583 CDD:275378 7/48 (15%)
leucine-rich repeat 585..610 CDD:275378 8/24 (33%)
leucine-rich repeat 611..622 CDD:275378 4/10 (40%)
TIR 823..960 CDD:214587
lgi1aNP_955921.2 LRR_8 57..113 CDD:290566 9/55 (16%)
LRR_4 77..120 CDD:289563 7/42 (17%)
leucine-rich repeat 79..102 CDD:275378 6/22 (27%)
LRR_8 101..161 CDD:290566 14/60 (23%)
LRR_4 101..141 CDD:289563 9/39 (23%)
leucine-rich repeat 103..126 CDD:275378 0/22 (0%)
leucine-rich repeat 127..150 CDD:275378 8/22 (36%)
leucine-rich repeat 151..163 CDD:275378 4/12 (33%)
TPKR_C2 159..207 CDD:301599 5/8 (63%)
EPTP 211..252 CDD:281697
EPTP 257..298 CDD:281697
EPTP 303..349 CDD:281697
EPTP 352..394 CDD:281697
EPTP 399..441 CDD:281697
EPTP 444..485 CDD:281697
EPTP 490..530 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.