DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MstProx and tlrs5

DIOPT Version :9

Sequence 1:NP_649719.2 Gene:MstProx / 40890 FlyBaseID:FBgn0015770 Length:965 Species:Drosophila melanogaster
Sequence 2:XP_002937550.2 Gene:tlrs5 / 100489423 XenbaseID:XB-GENE-22201327 Length:653 Species:Xenopus tropicalis


Alignment Length:575 Identity:119/575 - (20%)
Similarity:201/575 - (34%) Gaps:141/575 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 FNGKSHLRSLTFIGFQIENLSTKPF----------AQFINLKRMVLTNCTVRNLTFLRTLQKSLE 229
            |.|..:|.:|...|.:|.||..:.|          .....|...||.:...::||.|:.|..|..
 Frog   102 FRGFPNLITLDLGGNRIINLHPEAFEGLSWLEVLLLDHNGLDESVLESGMFKDLTSLKKLDLSFN 166

  Fly   230 HLELDIDNEVDLKYFT-NFSSLKFMKVRNYIPNKNFTALICTHKNCNFIRG---------INGLE 284
            ::.....:...||..: :|..|||.||          :::|.....| ::|         .|.|:
 Frog   167 NIRRVRPDPTFLKLSSISFLLLKFNKV----------SMLCGEDLQN-LQGRRLQLLDMSSNPLQ 220

  Fly   285 CPKLCQCLYIIDDLEL-NIDCSNLGL--------------LQIPPLPIPSYGGVKLNFSNNSLSQ 334
            ......|....:::.| .:|.|::|.              .|:..:.:....|:...|..::|..
 Frog   221 LSSTPHCTNPFNNITLGTLDVSSMGWNAEMVENFVRTISGTQVDYIKMRHTAGLGSGFGFHNLKD 285

  Fly   335 LPTMTLPGYKL--VKRLDVSRNRLTNLSINHLPA--KLDYLDVSFNEIINMGNDVIKYLRTVPIF 395
            ....|..|...  |:.||:|...:::|......|  ||..||:|.|:|..|.:.....|..:...
 Frog   286 PNKDTFSGLNSSNVQILDLSNGFISHLVPQLFSAFPKLLSLDLSSNQINRMSSGAFSGLGELVSL 350

  Fly   396 KQTGNQWTIHCDDKPLLNFFRHLKLIIRMKSAEMKPMFLHSLTELPKGFLKFLGKHFIWLGVRKQ 460
            ..:||                   |:..:..:..:.:...||..     |.....|     :...
 Frog   351 NLSGN-------------------LLGELMGSSFQGLGATSLKT-----LDLSSNH-----IGAV 386

  Fly   461 EYYLINEEQLLQSMHRKLNNLNTIMSIYKYMEWLHRKLIFVNREYDLFYIRQMAAPCPHKCECCY 525
            :|..::....|.|::.:.|.||.|..  ..::.:...|:..||..|::.|...   |||......
 Frog   387 QYGALDSFTALTSLNLRDNALNKIPP--TKLQGVTFVLLKQNRISDIYNIISF---CPHATILDL 446

  Fly   526 SRDSL----------------ILKIDCRNKFVYNFPDI--VARNSRLM---------------GK 557
            |.:.|                .|.:...:.:..:.|..  :.|.|.|:               |:
 Frog   447 SSNRLTDFRSLWQILELQSLKYLSLASNSLYRCSLPHTSNITRTSGLVYLDLSDNALGPVLKSGE 511

  Fly   558 -----QNMSSPMELHLSKNNISNITIAMLP--KELRFLDLRFNNLVTLDDKVLSYLKKNSIKTKL 615
                 .::.|...|:|::|.:|||...|..  ..|:.|||..|....:...:.:.|  .::||..
 Frog   512 CGDIFMHLGSLKSLNLARNQLSNIPDTMFRSLSSLQTLDLSGNGFKEIQSNLFTGL--TALKTLN 574

  Fly   616 SGNPWNCDCKSRSVLSILRDHEPLEY-DVTLKRCNISPTDCPDVCVCCL-DNLTW 668
            .|.. |....|.|||..|...|.::. :|||            ||.|.| |...|
 Frog   575 LGKS-NLVTLSSSVLDPLGSLESIDLSEVTL------------VCDCSLWDFWKW 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MstProxNP_649719.2 leucine-rich repeat 325..345 CDD:275378 4/19 (21%)
leucine-rich repeat 346..367 CDD:275378 6/22 (27%)
leucine-rich repeat 563..583 CDD:275378 7/21 (33%)
leucine-rich repeat 585..610 CDD:275378 6/24 (25%)
leucine-rich repeat 611..622 CDD:275378 3/10 (30%)
TIR 823..960 CDD:214587
tlrs5XP_002937550.2 PLN00113 100..>597 CDD:215061 110/542 (20%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
leucine-rich repeat 132..157 CDD:275380 4/24 (17%)
leucine-rich repeat 158..182 CDD:275380 5/23 (22%)
leucine-rich repeat 183..208 CDD:275380 9/35 (26%)
leucine-rich repeat 209..232 CDD:275380 3/22 (14%)
leucine-rich repeat 299..322 CDD:275380 6/22 (27%)
leucine-rich repeat 323..346 CDD:275380 8/22 (36%)
leucine-rich repeat 347..372 CDD:275380 3/43 (7%)
leucine-rich repeat 373..396 CDD:275380 4/32 (13%)
leucine-rich repeat 397..440 CDD:275380 12/47 (26%)
leucine-rich repeat 418..431 CDD:275378 3/12 (25%)
leucine-rich repeat 441..492 CDD:275380 5/50 (10%)
leucine-rich repeat 493..521 CDD:275380 2/27 (7%)
leucine-rich repeat 522..545 CDD:275380 7/22 (32%)
leucine-rich repeat 546..569 CDD:275380 6/24 (25%)
leucine-rich repeat 570..591 CDD:275380 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.