DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and KRTAP3-2

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_114165.1 Gene:KRTAP3-2 / 83897 HGNCID:16779 Length:98 Species:Homo sapiens


Alignment Length:69 Identity:20/69 - (28%)
Similarity:21/69 - (30%) Gaps:28/69 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CCGYYCC----GPC-----------CGPCGPRCGP----------CGSCCGPC---GPCGPCCGP 45
            ||....|    ||.           ||.|.|...|          |.:|..||   .||.|.|..
Human     3 CCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFL 67

  Fly    46 FGSC 49
            ..||
Human    68 LNSC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
KRTAP3-2NP_114165.1 Keratin_matx 3..96 CDD:461359 20/69 (29%)
3 X 5 AA repeats of C-C-X(3) 3..59 14/55 (25%)
Repetitive region 89..93
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.