Protein Alignment Mst84Dc and KRTAP3-1

DIOPT Version :10

• Sequence 1: NP_524254.1
• Gene: Mst84Dc / 40887
• FlyBaseID: FBgn0004174
• Length: 55
• Species: Drosophila melanogaster
• Sequence 2: NP_114164.1
• Gene: KRTAP3-1 / 83896
• HGNCID: 16778
• Length: 98
• Species: Homo sapiens
• Alignment Length: 68
• Identity: 21/68 - (30%)
• Similarity: 22/68 - (32%)
• Gaps: 29/68 - (42%)

  Fly    13 YCCG--PCCGPCGP-----------RCGPC-------------GSCCGPCGPCGPCCGPFGSCCG 51
            |||.  .|..|.||           |||.|             ..||..|.|  |||.| .:...
Human     2 YCCALRSCSVPTGPATTFCSFDKSCRCGVCLPSTCPHEISLLQPICCDTCPP--PCCKP-DTYVP 63

  Fly    52 GCW 54
            .||
Human    64 TCW 66

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Mst84Dc	NP_524254.1	None
KRTAP3-1	NP_114164.1	Keratin_matx	3..98	CDD:461359	20/67 (30%)
		4 X 5 AA repeats of C-C-X(3)	3..59		18/58 (31%)