DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap9-3

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_083627.2 Gene:Krtap9-3 / 75586 MGIID:1922836 Length:136 Species:Mus musculus


Alignment Length:104 Identity:29/104 - (27%)
Similarity:31/104 - (29%) Gaps:58/104 - (55%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCGPCGSCCGYYCCGP-CCGP-----------------------CGPRC-------GPC------ 29
            ||.|  |||...||.| ||..                       |.|.|       .||      
Mouse    31 CCQP--SCCEASCCQPSCCETGFGGGIGCGQEGGSGGVSCRVRWCRPDCRVEGTCLPPCCVVSCT 93

  Fly    30 -----------GSCCGP--CGPCGPCCGPFGSCCGGCWC 55
                       .|||.|  ||.  .||.|  :||  |:|
Mouse    94 PPTCCQLHHAQASCCRPSYCGQ--SCCRP--ACC--CYC 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap9-3NP_083627.2 Keratin_B2 1..131 CDD:366678 29/104 (28%)
Repetitive region 3..7
11 X 5 AA repeats of C-C-[AEQVR]-[ALPTV]-[AGHST] 21..130 29/104 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.