DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap1-5

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_081433.2 Gene:Krtap1-5 / 69664 MGIID:1916914 Length:122 Species:Mus musculus


Alignment Length:106 Identity:29/106 - (27%)
Similarity:31/106 - (29%) Gaps:60/106 - (56%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCGPCGSCCGYYCCGP-CCGP-------------------------CGPRC-------GPC---- 29
            ||.|  |||...|..| |||.                         |.|.|       .||    
Mouse    24 CCQP--SCCETSCFQPSCCGTGYGIGGGIGCGQEGGFGGVSCRVRWCRPDCRVEGTCLPPCCVVS 86

  Fly    30 -------------GSCCGP--CGPCGPCCGPFGSCCGGCWC 55
                         .|||.|  ||.  .||.|  :||  |:|
Mouse    87 CIPPTCCQLHHAQASCCRPSYCGQ--SCCRP--ACC--CYC 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap1-5NP_081433.2 Keratin_B2 1..111 CDD:366678 22/90 (24%)

Return to query results.
Submit another query.