DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap3-2

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_079996.2 Gene:Krtap3-2 / 66708 MGIID:1913958 Length:99 Species:Mus musculus


Alignment Length:70 Identity:21/70 - (30%)
Similarity:23/70 - (32%) Gaps:28/70 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SCCGYYCC----GPC-----------CGPCGPRCGP----------CGSCCGPC---GPCGPCCG 44
            :||...||    ||.           ||.|.|...|          |.:|..||   .||.|.|.
Mouse     2 ACCVARCCSVPTGPATTICSSDKSCRCGVCLPSTCPHTIWQLEPTCCDNCPPPCHIPQPCVPTCF 66

  Fly    45 PFGSC 49
            ...||
Mouse    67 LLNSC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap3-2NP_079996.2 Keratin_matx 3..98 CDD:461359 21/69 (30%)
3 X 5 AA repeats of C-C-X(3). /evidence=ECO:0000255 3..59 15/55 (27%)

Return to query results.
Submit another query.