DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Kplce

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_079897.2 Gene:Kplce / 66533 MGIID:1913783 Length:280 Species:Mus musculus


Alignment Length:79 Identity:27/79 - (34%)
Similarity:29/79 - (36%) Gaps:32/79 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCGPCGS--CC-------------------GY-----YCC--GPCCGPCGPRCGPCGSCCGPCGP 38
            |..||.:  ||                   |:     .||  ..||...|  ||.||. ||.||.
Mouse   186 CSAPCSTSYCCLAPRSFGVSPLRRWIQRPQGWNTGSSSCCEDSGCCSSGG--CGGCGG-CGGCGG 247

  Fly    39 CGPCCGPFGSCCGG 52
            |..|||. |.||.|
Mouse   248 CNSCCGS-GCCCLG 260

Return to query results.
Submit another query.