DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap9-5

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001078996.1 Gene:Krtap9-5 / 435286 MGIID:3650333 Length:358 Species:Mus musculus


Alignment Length:81 Identity:29/81 - (35%)
Similarity:30/81 - (37%) Gaps:33/81 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCGPC--GSCCGYYCCGP------------CCGP------CGPRCGPC-GSCCGP------CGPC 39
            ||.|.  .|||...||.|            ||.|      |.|.|  | .:||.|      |.| 
Mouse   116 CCKPACVTSCCSPPCCQPSSCETTCYRTTCCCKPTCVTSCCQPSC--CETTCCKPACVASCCSP- 177

  Fly    40 GPCCGPFGSCCGGCWC 55
             |||.|  |||....|
Mouse   178 -PCCQP--SCCETTCC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap9-5NP_001078996.1 Keratin_B2 55..227 CDD:366678 29/81 (36%)
Keratin_B2 199..338 CDD:366678
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.