DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap31-2

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001020415.1 Gene:Krtap31-2 / 432602 MGIID:3650789 Length:177 Species:Mus musculus


Alignment Length:95 Identity:31/95 - (32%)
Similarity:33/95 - (34%) Gaps:44/95 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCCGP--------CGS--C--------CGYYCCGP-CCGP-------CGPRC------GPC--GS 31
            :||.|        |.|  |        |...||.| ||.|       |.|.|      .||  .|
Mouse    33 ICCAPSWCSTPCCCKSICCHSTKTVNSCSQLCCPPTCCDPASCDSNCCKPTCVTICCSTPCCQPS 97

  Fly    32 CCGP-CGPCGP-----CCGPFGSCCGGCWC 55
            ||.| |  |.|     ||.|  :||....|
Mouse    98 CCVPTC--CQPSLFQLCCQP--TCCETSCC 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap31-2NP_001020415.1 Keratin_B2 5..125 CDD:366678 31/95 (33%)
Keratin_B2_2 64..107 CDD:464017 17/44 (39%)

Return to query results.
Submit another query.