DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and KRTAP10-12

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_941972.1 Gene:KRTAP10-12 / 386685 HGNCID:20533 Length:245 Species:Homo sapiens


Alignment Length:76 Identity:29/76 - (38%)
Similarity:30/76 - (39%) Gaps:22/76 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CC------GPCGSCCGYYCCGPCC--GPCGPRC---GPC-GSCCGP-------CGP--CGP-CCG 44
            ||      .||.|.|...|...||  ..|.|.|   .|| .:||.|       |.|  |.| |||
Human    62 CCRVTCEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKTVCCKPVCCMPVCCG 126

  Fly    45 PFGSCCGGCWC 55
            |..|||....|
Human   127 PSSSCCQQSSC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
KRTAP10-12NP_941972.1 Keratin_B2 30..166 CDD:366678 29/76 (38%)
19 X 5 AA repeats of C-C-X(3) 36..218 29/76 (38%)
Keratin_B2_2 173..224 CDD:464017
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.