DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and KRTAP10-9

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_941963.2 Gene:KRTAP10-9 / 386676 HGNCID:22971 Length:292 Species:Homo sapiens


Alignment Length:82 Identity:30/82 - (36%)
Similarity:30/82 - (36%) Gaps:35/82 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CC--GPCGS------CCGYYCCGP-CCGP--------------CGPRCGPC-GSCCGP------- 35
            ||  .||..      ||...||.| ||.|              |.|.|  | .|||.|       
Human   172 CCTSSPCQQSYCVPVCCKPVCCKPICCVPVCSGASSLCCQQSGCQPAC--CTTSCCRPSSSVSLL 234

  Fly    36 CGP-CGP-CCGPFGSCC 50
            |.| |.| ||.|..|||
Human   235 CRPVCRPACCVPVSSCC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
KRTAP10-9NP_941963.2 25 X 5 AA repeats of C-C-X(3) 26..254 30/82 (37%)
Keratin_B2 78..246 CDD:366678 26/75 (35%)

Return to query results.
Submit another query.