DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and KRTAP5-9

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_005544.4 Gene:KRTAP5-9 / 3846 HGNCID:23604 Length:169 Species:Homo sapiens


Alignment Length:82 Identity:35/82 - (42%)
Similarity:35/82 - (42%) Gaps:30/82 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGPCG--------SCCG-YYCCGP--CCGP------CGPR-CGPCGSCCGPCGPCG--------P 41
            ||.||        |||. .|||.|  ||.|      ||.| ||.||...|.||.||        |
Human    21 CGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKRGCGSCGGSKGGCGSCGCSQCSCCKP 85

  Fly    42 CC---GPFGSCCGGCWC 55
            ||   |...||| .|.|
Human    86 CCCSSGCGSSCC-QCSC 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
KRTAP5-9NP_005544.4 8 X 4 AA repeats of C-C-X-P 35..162 30/68 (44%)

Return to query results.
Submit another query.