DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and idpp-7

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_502429.1 Gene:idpp-7 / 178227 WormBaseID:WBGene00011949 Length:160 Species:Caenorhabditis elegans


Alignment Length:74 Identity:25/74 - (33%)
Similarity:26/74 - (35%) Gaps:22/74 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCG-----PCGS--CCGYYCCGPCCGPCG---PRCGPC-----------GSCCGPCGP-CGPCCG 44
            |||     .|||  .||..||.....||.   |.|..|           .:||..|.| |...|.
 Worm    59 CCGGMSGCGCGSMGMCGQTCCPSAPPPCSCGTPGCMQCVQQTVLVPVTTTTCCKCCQPVCTNACT 123

  Fly    45 PFGSCCGGC 53
            ..|.|..||
 Worm   124 NGGGCSCGC 132

Return to query results.
Submit another query.