DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap12-1

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_034800.1 Gene:Krtap12-1 / 16694 MGIID:1328315 Length:130 Species:Mus musculus


Alignment Length:56 Identity:20/56 - (35%)
Similarity:21/56 - (37%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCCGPCGSCCGYYCCGPCCGPCGPRC---GPCGSCCGPCGPCGPCCGPFGSCCGGC 53
            ||...|.|.|...||  ....|.|.|   .||.:.|....||.|.|....||...|
Mouse     1 MCHTSCSSGCQPSCC--VSSSCQPSCCVSSPCQASCFVSSPCQPSCCVSSSCQSAC 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap12-1NP_034800.1 Keratin_B2 7..130 CDD:366678 17/50 (34%)
14 X 5 AA approximate repeats. /evidence=ECO:0000255 10..128 16/47 (34%)

Return to query results.
Submit another query.