DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap12-20

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001191962.1 Gene:Krtap12-20 / 100502953 MGIID:3642388 Length:120 Species:Mus musculus


Alignment Length:68 Identity:27/68 - (39%)
Similarity:27/68 - (39%) Gaps:22/68 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCCGPCGSCCGYYCC--GP----CC--GPCGPRC---GPCGSCCGPCGP--CGP------CCGPF 46
            ||...|.|.|...||  .|    ||  .||.|.|   .||.|.|  |.|  |.|      ||.|.
Mouse     1 MCHTSCSSGCQPSCCVSSPCQPSCCVSSPCQPSCCVSSPCQSAC--CRPAICIPVRYQVACCVPV 63

  Fly    47 GSC 49
             ||
Mouse    64 -SC 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap12-20NP_001191962.1 Keratin_B2 7..120 CDD:366678 24/62 (39%)
Keratin_B2_2 10..53 CDD:464017 17/44 (39%)

Return to query results.
Submit another query.