DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst84Dc and Krtap12-22

DIOPT Version :10

Sequence 1:NP_524254.1 Gene:Mst84Dc / 40887 FlyBaseID:FBgn0004174 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001074921.1 Gene:Krtap12-22 / 100009614 MGIID:3641784 Length:119 Species:Mus musculus


Alignment Length:62 Identity:21/62 - (33%)
Similarity:22/62 - (35%) Gaps:14/62 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCCGPCGSCCGYYCCGPCCGPCGPRC---GPCGSCCGPCGPC-GPCCGPF--------GSCC 50
            ||...|.|.|...||  ...||.|.|   .||.|.|.....| ..||.|.        .:||
Mouse     1 MCHTSCSSGCQPSCC--VSSPCQPSCCVSNPCQSSCCVSSSCQSACCRPAICIPVRYQVACC 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst84DcNP_524254.1 None
Krtap12-22NP_001074921.1 Keratin_B2 <7..94 CDD:366678 18/56 (32%)

Return to query results.
Submit another query.