DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf4 and MEX67

DIOPT Version :10

Sequence 1:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_015156.1 Gene:MEX67 / 855934 SGDID:S000006090 Length:599 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:44/153 - (28%)
Similarity:75/153 - (49%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VLLDRYDPVERSLDLTLFYKDKALC--GEFFALA-ESNCMSTVLGIVDREMPEL-ERLILDGNHL 201
            |||.||||..:.|:|...:.|..|.  |.|.::: :|.....::.:...|...: |.:.|..|.|
Yeast   110 VLLKRYDPQTKLLNLGALHSDPELIQKGVFSSISTQSKMFPAMMKLASTEKSLIVESVNLADNQL 174

  Fly   202 TNLWVFRKVERRFPRLHSISLKHNDIENIYSL---RNLQFLPLAELNLLDNPLPAG--YEKEVLD 261
            .::.....:.:.||.|.::.|.:|.|....||   :| :|..|.||.:.:||:...  |..|:|.
Yeast   175 KDISAISTLAQTFPNLKNLCLANNQIFRFRSLEVWKN-KFKDLRELLMTNNPITTDKLYRTEMLR 238

  Fly   262 IWPSLQVLNKIQVTPDPAMMQLV 284
            ::|.|.||:.: :..|...:|.|
Yeast   239 LFPKLVVLDNV-IVRDEQKLQTV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 8/42 (19%)
PPP1R42 <191..276 CDD:455733 26/90 (29%)
leucine-rich repeat 191..216 CDD:275382 5/25 (20%)
leucine-rich repeat 217..240 CDD:275382 8/25 (32%)
MEX67NP_015156.1 RRM_9 23..92 CDD:408240
leucine-rich repeat 119..163 CDD:275382 8/43 (19%)
PPP1R42 <155..256 CDD:455733 28/102 (27%)
leucine-rich repeat 164..189 CDD:275382 5/24 (21%)
leucine-rich repeat 190..217 CDD:275382 8/27 (30%)
leucine-rich repeat 218..242 CDD:275382 7/23 (30%)
TAP_C 537..597 CDD:197882
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.