DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf4 and Nxf2

DIOPT Version :9

Sequence 1:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001276664.1 Gene:Nxf2 / 83454 MGIID:1933192 Length:691 Species:Mus musculus


Alignment Length:250 Identity:59/250 - (23%)
Similarity:103/250 - (41%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 WYRVLIYSTDRRLTFNRVLRRIR--CILTPLKINPRYKHTGGEQDTAEDSWALFTFFVDSYDVAS 105
            ||:|.|.| .|:.....::|.|:  |....:.::..|..|...            |||.:...||
Mouse   125 WYKVTIPS-GRKYEKTWLMRSIQNFCSEPFIPVDFHYDKTQAR------------FFVQNAKTAS 176

  Fly   106 ALFRRGWVDNQIWLKVSD---RMPKIWIN-SILRL------------HLTMVLLDRYDPVERSLD 154
            ||       ..:..::.|   |...|::: |::..            ::...:::|||..:::||
Mouse   177 AL-------KDVSYRICDETSRKIAIFVSPSVVPYSVQNKFTSEQMEYIRESMMNRYDASQKALD 234

  Fly   155 LTLFYKDKALCGE--FFALAESNCMSTVLGIVDREMPELERLILDGNHLTNLWVFRKVERRFPRL 217
            |..|..|:.|..:  ...|...:||...|.|:..::|||..|.|..|.|..|.....:..:.|.:
Mouse   235 LEKFRFDQDLMDKDIDMMLNRRSCMVATLQIIQSDIPELLSLNLTNNKLYQLDGLSDMTEKAPHV 299

  Fly   218 HSISLKHNDIENIYSLRNLQFLPLAELNLLDNPL------PAGYEKEVLDIWPSL 266
            ..::|..|.:::...|..::.|.|.||.|..||.      ...|...:.|::|.|
Mouse   300 KILNLSRNKLKSFTELEKVKELKLEELWLEGNPFCNCFLDHFEYISTIHDLFPKL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 11/41 (27%)
LRR_4 189..235 CDD:289563 12/45 (27%)
leucine-rich repeat 191..216 CDD:275382 6/24 (25%)
leucine-rich repeat 217..240 CDD:275382 3/22 (14%)
Nxf2NP_001276664.1 Tap-RNA_bind 123..204 CDD:286271 22/98 (22%)
leucine-rich repeat 230..272 CDD:275382 11/41 (27%)
LRR_4 271..317 CDD:289563 12/45 (27%)
leucine-rich repeat 273..298 CDD:275382 6/24 (25%)
leucine-rich repeat 299..322 CDD:275382 3/22 (14%)
leucine-rich repeat 323..353 CDD:275382 8/29 (28%)
NTF2_like 451..606 CDD:298832
TAP_C 630..691 CDD:197882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.