DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf4 and nxf1a

DIOPT Version :9

Sequence 1:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_009306018.1 Gene:nxf1a / 751719 ZFINID:ZDB-GENE-060825-299 Length:642 Species:Danio rerio


Alignment Length:243 Identity:66/243 - (27%)
Similarity:103/243 - (42%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GDFKFESKNGARLPRSIYGWYRVLI---YSTDRRLTFNRVLRRIRCILTPLKINPRYKHTGGEQD 85
            ||   |.|.|.:       |:::.|   ...|:|.....:..     |.|:...|.:..|.|:: 
Zfish   135 GD---EKKGGKQ-------WFKMTIPHGKKYDKRWLLTSLQN-----LCPIAFTPLHYTTEGDK- 183

  Fly    86 TAEDSWALFTFFVDSYDVASALFR--RGWVDNQ----IWLKVSDRMPKIWINSILRLH----LTM 140
                    ..|:::....||||.:  |..:|:.    :.|..|...|. ::.|.|||.    |.:
Zfish   184 --------VHFYLEDTTTASALSKLSRRILDSDGQRVVVLMNSCYFPP-FLKSELRLEDLELLKL 239

  Fly   141 VLLDRYDPVERSLDLTLFYKDKALCGE--FFALAESNCMSTVLGIVDREMPELERLILDGNHLTN 203
            .|..|:|..::|||||....|..|...  ...|...|||..|:.|:...:|||..|.|..|.|..
Zfish   240 CLSKRFDDSQKSLDLTSIRTDPELVSHNVDIILNRKNCMQAVIKIIQESIPELLSLNLSKNKLYK 304

  Fly   204 LWVFRKVERRFPRLHSISLKHNDIENIYSLRNLQFLPLAELNLLDNPL 251
            |....::..:.|.|.|::|..|::::...|..::...|.||.|..|||
Zfish   305 LDGLTELVNKAPNLQSLNLSCNELKSHCELDKVKGFRLVELCLDGNPL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 13/41 (32%)
LRR_4 189..235 CDD:289563 14/45 (31%)
leucine-rich repeat 191..216 CDD:275382 6/24 (25%)
leucine-rich repeat 217..240 CDD:275382 5/22 (23%)
nxf1aXP_009306018.1 Tap-RNA_bind 142..223 CDD:286271 18/101 (18%)
leucine-rich repeat 249..291 CDD:275382 13/41 (32%)
LRR_4 290..336 CDD:289563 14/45 (31%)
leucine-rich repeat 292..317 CDD:275382 6/24 (25%)
leucine-rich repeat 318..341 CDD:275382 5/22 (23%)
leucine-rich repeat 342..372 CDD:275382 7/11 (64%)
NTF2 413..561 CDD:238403
TAP_C 579..641 CDD:197882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.