| Sequence 1: | NP_731156.1 | Gene: | nxf4 / 40884 | FlyBaseID: | FBgn0051501 | Length: | 301 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001093156.1 | Gene: | NXF2B / 728343 | HGNCID: | 23984 | Length: | 626 | Species: | Homo sapiens |
| Alignment Length: | 197 | Identity: | 56/197 - (28%) |
|---|---|---|---|
| Similarity: | 81/197 - (41%) | Gaps: | 35/197 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 96 FFVDSYDVASALFRRGWVDNQIWLKV-SDRMPKIWI-----------------NSILRLHLTMVL 142
Fly 143 LDRYDPVERSLDLTLFYKDKALCGE--FFALAESNCMSTVLGIVDREMPELERLILDGNHLTNLW 205
Fly 206 VFRKVERRFPRLHSISLKHNDIENIYSLRNLQFLPLAELNLLDNPL------PAGYEKEVLDIWP 264
Fly 265 SL 266 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| nxf4 | NP_731156.1 | leucine-rich repeat | 150..190 | CDD:275382 | 13/41 (32%) |
| LRR_4 | 189..235 | CDD:289563 | 13/45 (29%) | ||
| leucine-rich repeat | 191..216 | CDD:275382 | 6/24 (25%) | ||
| leucine-rich repeat | 217..240 | CDD:275382 | 4/22 (18%) | ||
| NXF2B | NP_001093156.1 | Tap-RNA_bind | 121..203 | CDD:312616 | 12/43 (28%) |
| leucine-rich repeat | 229..271 | CDD:275382 | 13/41 (32%) | ||
| LRR_8 | 270..332 | CDD:316378 | 19/61 (31%) | ||
| LRR 1 | 271..296 | 7/24 (29%) | |||
| leucine-rich repeat | 272..297 | CDD:275382 | 6/24 (25%) | ||
| LRR 2 | 297..320 | 4/22 (18%) | |||
| leucine-rich repeat | 298..321 | CDD:275382 | 4/22 (18%) | ||
| LRR 3 | 321..348 | 8/26 (31%) | |||
| leucine-rich repeat | 322..352 | CDD:275382 | 9/29 (31%) | ||
| LRR 4 | 349..376 | 2/5 (40%) | |||
| NTF2_like | 391..543 | CDD:324324 | |||
| TAP_C | 570..623 | CDD:197882 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||