DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf4 and NXF2B

DIOPT Version :10

Sequence 1:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001093156.1 Gene:NXF2B / 728343 HGNCID:23984 Length:626 Species:Homo sapiens


Alignment Length:197 Identity:56/197 - (28%)
Similarity:81/197 - (41%) Gaps:35/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 FFVDSYDVASALFRRGWVDNQIWLKV-SDRMPKIWI-----------------NSILRLHLTMVL 142
            |||.....||||       ..:..|: .|...||.|                 ..:..|.|||  
Human   166 FFVQDASAASAL-------KDVSYKIYDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTM-- 221

  Fly   143 LDRYDPVERSLDLTLFYKDKALCGE--FFALAESNCMSTVLGIVDREMPELERLILDGNHLTNLW 205
            ..||:..:::|||.....|..|.|.  ...|...|||:..|.|::|..|||..|.|..|.|..|.
Human   222 NKRYNVSQQALDLQNLRFDPDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLD 286

  Fly   206 VFRKVERRFPRLHSISLKHNDIENIYSLRNLQFLPLAELNLLDNPL------PAGYEKEVLDIWP 264
            ....:..:.|::.:::|..|.:|:.:.|..::.|.|.||.|..|||      .:.|...:.|.:|
Human   287 GLSDITEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP 351

  Fly   265 SL 266
            .|
Human   352 KL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 13/41 (32%)
PPP1R42 <191..276 CDD:455733 23/82 (28%)
leucine-rich repeat 191..216 CDD:275382 6/24 (25%)
leucine-rich repeat 217..240 CDD:275382 4/22 (18%)
NXF2BNP_001093156.1 Tap-RNA_bind 124..203 CDD:462696 12/43 (28%)
PPP1R42 <227..363 CDD:455733 38/127 (30%)
leucine-rich repeat 229..271 CDD:275382 13/41 (32%)
LRR <268..>332 CDD:443914 19/63 (30%)
LRR 1 271..296 7/24 (29%)
leucine-rich repeat 272..297 CDD:275382 6/24 (25%)
LRR 2 297..320 4/22 (18%)
leucine-rich repeat 298..321 CDD:275382 4/22 (18%)
LRR 3 321..348 8/26 (31%)
leucine-rich repeat 322..352 CDD:275382 9/29 (31%)
LRR 4 349..376 2/5 (40%)
NTF2_like 391..543 CDD:471850
TAP_C 570..623 CDD:197882
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.