Sequence 1: | NP_731156.1 | Gene: | nxf4 / 40884 | FlyBaseID: | FBgn0051501 | Length: | 301 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071335.1 | Gene: | NXF3 / 56000 | HGNCID: | 8073 | Length: | 531 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 32/206 - (15%) |
---|---|---|---|
Similarity: | 73/206 - (35%) | Gaps: | 52/206 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 TPRSVKGDFKFESKNGARLPR----------------SIYGWYRVLI---YSTDRRLTFNRVLRR 63
Fly 64 IRCILTPLKINPRYKHTGGEQDTAEDSWALFTFFVDSYDVASALFRRGWVDNQIWLKVSDRMPKI 128
Fly 129 WINSILRLH-------------LTMVLLDRYDPVERSLDLTL--FYKDKALCGEFFALAESNCMS 178
Fly 179 TVLGIVDREMP 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nxf4 | NP_731156.1 | leucine-rich repeat | 150..190 | CDD:275382 | 10/42 (24%) |
LRR_4 | 189..235 | CDD:289563 | 1/1 (100%) | ||
leucine-rich repeat | 191..216 | CDD:275382 | |||
leucine-rich repeat | 217..240 | CDD:275382 | |||
NXF3 | NP_071335.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 33..59 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 83..106 | 1/22 (5%) | |||
Tap-RNA_bind | 110..192 | CDD:312616 | 15/99 (15%) | ||
noncanonical RNP-type RNA-binding (RBD) domain | 115..192 | 14/94 (15%) | |||
leucine-rich repeat (LRR) domains | 193..329 | 11/67 (16%) | |||
leucine-rich repeat | 218..260 | CDD:275382 | 10/42 (24%) | ||
leucine-rich repeat | 275..305 | CDD:275382 | |||
nuclear transport factor 2 (NTF2)-like domain | 339..461 | ||||
NTF2 | 341..496 | CDD:238403 | |||
ubiquitin-associated domain | 524..531 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3763 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |