DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf4 and nxf2

DIOPT Version :10

Sequence 1:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster


Alignment Length:206 Identity:47/206 - (22%)
Similarity:89/206 - (43%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 QIWLKVSDRMPKIWINSILRLHLTMVLLDRYDPVE--------------RSLDLTLFYKDKALCG 166
            ::.:...||:.:.:    ||::::.|.....||.|              |.|:|..|:..:.|..
  Fly   390 EMTIPTGDRIFRYY----LRMNVSTVKQHHVDPEECIQKAVSQCYVAQNRMLNLERFHSRECLKD 450

  Fly   167 EFFALAESNCMSTVLGIVDREM----PEL-----ERLILDGNHLTNLWVFRKVERRFPRLHSISL 222
            ...:|:....::.||.:..|:.    .|:     :.|:|||.|:..:         ...|.::.|
  Fly   451 VMVSLSSPKILTYVLSVASRKFMTTCSEIRLCHNKVLVLDGAHVLGM---------MGCLRAVDL 506

  Fly   223 KHNDIENIYSLRNLQFLPLAELNLLDNP------LPAGYEKEVLDIWPSLQVLNKIQVTPDPAMM 281
            .||.::::.|:.:|..|||..|.|..|.      ||:.|.:.|.:::|.|..|:.:.:..:|. .
  Fly   507 SHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLPSEYVRAVKEVFPQLTTLDGVDLQTNPG-Q 570

  Fly   282 QLVERVLQHTG 292
            .|.:..|..||
  Fly   571 SLQKNFLCDTG 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 10/57 (18%)
PPP1R42 <191..276 CDD:455733 24/95 (25%)
leucine-rich repeat 191..216 CDD:275382 5/29 (17%)
leucine-rich repeat 217..240 CDD:275382 6/22 (27%)
nxf2NP_524111.3 PPP1R42 <206..284 CDD:455733
leucine-rich repeat 434..474 CDD:275382 9/39 (23%)
leucine-rich repeat 475..500 CDD:275382 6/33 (18%)
leucine-rich repeat 501..524 CDD:275382 6/22 (27%)
leucine-rich repeat 525..555 CDD:275382 8/29 (28%)
TAP_C 779..841 CDD:197882
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.