DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf4 and ssp2

DIOPT Version :9

Sequence 1:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001287065.1 Gene:ssp2 / 39540 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster


Alignment Length:166 Identity:38/166 - (22%)
Similarity:67/166 - (40%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NSILRLHLTMVLLDRYDPVERSLDLTL---FYKDKALCGEFFALAESNCMSTVLGIVDREMPELE 192
            |.:..|.....|.:....:::||| |:   |::|:|...|    .|.....:....||..     
  Fly   478 NMLAELGKVNTLNEEQLKMQKSLD-TIKRRFHRDEAEAEE----REEELQQSAAEKVDTP----- 532

  Fly   193 RLILDGNHLTNLWVFRKVER---RFPRLH---SISLKHNDIENIYSLRNLQFL-PLAELNLLDNP 250
              :|:.:|.::.......||   |..||:   ::|..|....:..|..:..|: ...::..::.|
  Fly   533 --VLNQSHSSSNSSGGGGERLLSRRSRLYDDVNLSAMHGSNGSSTSTNSASFIVQRRDMPQVEQP 595

  Fly   251 LPAGYEKEVLDIWPSLQVLNKIQVTPDPAMMQLVER 286
            .| ..:.|..:..|..||..:|    |||..:|.||
  Fly   596 AP-DPDPEPAEEPPKSQVTAEI----DPASYKLPER 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 11/42 (26%)
LRR_4 189..235 CDD:289563 10/51 (20%)
leucine-rich repeat 191..216 CDD:275382 5/27 (19%)
leucine-rich repeat 217..240 CDD:275382 5/26 (19%)
ssp2NP_001287065.1 PHA03247 <676..965 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.