DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf4 and nxf-2

DIOPT Version :10

Sequence 1:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_506568.2 Gene:nxf-2 / 179938 WormBaseID:WBGene00003835 Length:405 Species:Caenorhabditis elegans


Alignment Length:146 Identity:33/146 - (22%)
Similarity:57/146 - (39%) Gaps:18/146 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 YDPVERSLDLTLFYK-------DKALCGEFFALAESNCMSTVLGIVDREMPELERLILDGNHLTN 203
            |...:..|:|:.|.|       |..:|     |.::..||.||..:..:.|.:..:....|.|.:
 Worm    51 YVATDDVLNLSNFSKNTEFVERDMLMC-----LTKTRVMSVVLQHIGYKYPRISGISFSNNRLCH 110

  Fly   204 LWVFRKVERRFPRLHSISLKHNDIENIYSLRNLQFLPLAELNLLDNPL------PAGYEKEVLDI 262
            |.....:......|..:.|.||.|.:...|:.|..:|:..:....||:      .|.|...:...
 Worm   111 LDHLSSLSSISKFLKFLDLSHNQISSGEELKKLGTIPVETVFFEGNPVCEKFVQCAEYANFIQKT 175

  Fly   263 WPSLQVLNKIQVTPDP 278
            :|....|:.::|.|.|
 Worm   176 FPKCSNLDGMEVEPKP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 11/46 (24%)
PPP1R42 <191..276 CDD:455733 18/90 (20%)
leucine-rich repeat 191..216 CDD:275382 3/24 (13%)
leucine-rich repeat 217..240 CDD:275382 7/22 (32%)
nxf-2NP_506568.2 leucine-rich repeat 55..97 CDD:275382 11/46 (24%)
PPP1R42 <96..159 CDD:455733 14/62 (23%)
leucine-rich repeat 98..123 CDD:275382 3/24 (13%)
leucine-rich repeat 124..147 CDD:275382 7/22 (32%)
leucine-rich repeat 148..178 CDD:275382 4/29 (14%)

Return to query results.
Submit another query.