DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rn and VEZF1

DIOPT Version :9

Sequence 1:NP_001262343.1 Gene:rn / 40879 FlyBaseID:FBgn0267337 Length:952 Species:Drosophila melanogaster
Sequence 2:XP_005257700.1 Gene:VEZF1 / 7716 HGNCID:12949 Length:527 Species:Homo sapiens


Alignment Length:533 Identity:114/533 - (21%)
Similarity:167/533 - (31%) Gaps:201/533 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 AHHHNQAVAAASAAALL-----------VVPQPINASKMGGPGGVSSVAGGHATGGGSGRKYQCK 491
            |.||.|..|..|...||           ::|.||.....|.|..:....|  .........:.|.
Human    15 ASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKPQGAPETLKDAIG--IKKEKPKTSFVCT 77

  Fly   492 MCPQIFSSKADLQLHTQIH---------------------------------------------- 510
            .|.:.|.....|:.|...|                                              
Human    78 YCSKAFRDSYHLRRHESCHTGIKLVSRPKKTPTTVVPLISTIAGDSSRTSLVSTIAGILSTVTTS 142

  Fly   511 ---------------------MREAKPYK----CTQCSKAFANSSYLSQHTRIHLGIKPYRCEIC 550
                                 .:.:||.|    |..|.|||.:..:|::|...|...||:.|.||
Human   143 SSGTNPSSSASTTAMPVTQSVKKPSKPVKKNHACEMCGKAFRDVYHLNRHKLSHSDEKPFECPIC 207

  Fly   551 QRKFTQLSHLQQHIRTHTG--DKPYKCRHPGCQKAFSQLSNLQSH-SRCHQTDKPFKC------N 606
            .::|.:...:..|:|:|.|  .|||.|  ..|.|.||:..:|..| ...|.|::||||      .
Human   208 NQRFKRKDRMTYHVRSHEGGITKPYTC--SVCGKGFSRPDHLSCHVKHVHSTERPFKCQFSSLMQ 270

  Fly   607 SCYKCFSDEPSLLEHIPKHKESKHLKTHICQYCGKSYTQETYLTKHMQKHAERTDKRPPIVPGSA 671
            :|...|:.:..|..|:.:|:....     |..||| .....|:|.|::.|               
Human   271 TCTAAFATKDRLRTHMVRHEGKVS-----CNICGK-LLSAAYITSHLKTH--------------- 314

  Fly   672 AAIAAAAAAAAGGSANPANGPPPPPNPAQHQRNNLGLPPVSIAPSDNGYWPKVSPDSAAAANAME 736
                                       .|.|..|.......|:.:                    
Human   315 ---------------------------GQSQSINCNTCKQGISKT-------------------- 332

  Fly   737 VMHQQQQQQQQQQQQQQQQQQQQQQQAHHHHPQHGVPPQQHV---PPQQ-------QQQQQQQQQ 791
            .|.::...|:||||||||||||||||            ||||   |.:|       ::..:.:::
Human   333 CMSEETSNQKQQQQQQQQQQQQQQQQ------------QQHVTSWPGKQVETLRLWEEAVKARKK 385

  Fly   792 HHHPQQQPPPQHSMEAHYAQPTAPNGSQSNGHGAELQPHHRMPDPVREDIASTPSAVGPYDAASI 856
            ......|.....:.......|.:...|.|:|         .|.:||  .:|:..|...|.:.:|.
Human   386 EAANLCQTSTAATTPVTLTTPFSITSSVSSG---------TMSNPV--TVAAAMSMRSPVNVSSA 439

  Fly   857 TKTTSNSAFTPIN 869
            ...||     |:|
Human   440 VNITS-----PMN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnNP_001262343.1 C2H2 Zn finger 490..510 CDD:275368 5/19 (26%)
C2H2 Zn finger 519..539 CDD:275368 7/19 (37%)
zf-H2C2_2 531..556 CDD:290200 9/24 (38%)
zf-C2H2 545..567 CDD:278523 6/21 (29%)
C2H2 Zn finger 547..567 CDD:275368 6/19 (32%)
zf-C2H2_8 550..630 CDD:292531 27/88 (31%)
zf-H2C2_2 559..586 CDD:290200 11/28 (39%)
C2H2 Zn finger 575..597 CDD:275368 7/22 (32%)
C2H2 Zn finger 605..625 CDD:275368 5/25 (20%)
C2H2 Zn finger 636..656 CDD:275368 7/19 (37%)
VEZF1XP_005257700.1 C2H2 Zn finger 76..96 CDD:275368 5/19 (26%)
C2H2 Zn finger 176..196 CDD:275368 7/19 (37%)
zf-H2C2_2 188..213 CDD:290200 9/24 (38%)
C2H2 Zn finger 204..224 CDD:275368 6/19 (32%)
C2H2 Zn finger 234..252 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..289 CDD:275368 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.