DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rn and MYNN

DIOPT Version :9

Sequence 1:NP_001262343.1 Gene:rn / 40879 FlyBaseID:FBgn0267337 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001172047.1 Gene:MYNN / 55892 HGNCID:14955 Length:610 Species:Homo sapiens


Alignment Length:369 Identity:105/369 - (28%)
Similarity:147/369 - (39%) Gaps:86/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 TPRSHQHASEHHPMSLKQEYEAKMNDHHHNNLQKGHFLDDNRLEHHAVTGQGGLGLGASNGVGGG 415
            :|::.|:.:..:|..:.:....::            |||.|:|....|.....:...:...:   
Human   188 SPKTGQNKTVQYPSDILENASVEL------------FLDANKLPTPVVEQVAQINDNSELEL--- 237

  Fly   416 GGGASVVGNSSLGASSHHAVAAAHHH-----NQAVAAASAAALLVVPQPINASKMGGP------- 468
               .|||.|:.......|.|......     |.|:...|.:.:..|..|..|...|..       
Human   238 ---TSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSGEELDQRYSK 299

  Fly   469 --------GGVSSVAGG----------------HATGGG--------------SGRK-YQCKMCP 494
                    |.|.|.|..                |..|..              :|.| |:|::|.
Human   300 AKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCELCD 364

  Fly   495 QIFSSKADLQLHTQIHMREAKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSH 559
            :.|:.|..|..|:::|..|.|||||..|:..||.||.|..|.|.|.|.|||.|:.|.::|.|.|.
Human   365 KGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQAST 429

  Fly   560 LQQHIRTHTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEPSLLEHIPK 624
            |..|:|.|||:|||.|  ..|.|||:..|:|.:|||.|..:||:.|..|.|.|.....|      
Human   430 LTYHVRRHTGEKPYVC--DTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGEL------ 486

  Fly   625 HKESKHLKTH------ICQYCGKSYTQETYLTKHMQKHAERTDK 662
               :||.::|      ||:.||.|||....|.||..|.....||
Human   487 ---NKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnNP_001262343.1 C2H2 Zn finger 490..510 CDD:275368 6/19 (32%)
C2H2 Zn finger 519..539 CDD:275368 9/19 (47%)
zf-H2C2_2 531..556 CDD:290200 11/24 (46%)
zf-C2H2 545..567 CDD:278523 9/21 (43%)
C2H2 Zn finger 547..567 CDD:275368 8/19 (42%)
zf-C2H2_8 550..630 CDD:292531 31/79 (39%)
zf-H2C2_2 559..586 CDD:290200 14/26 (54%)
C2H2 Zn finger 575..597 CDD:275368 10/21 (48%)
C2H2 Zn finger 605..625 CDD:275368 5/19 (26%)
C2H2 Zn finger 636..656 CDD:275368 9/19 (47%)
MYNNNP_001172047.1 BTB 14..115 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..197 2/8 (25%)
Nuclear localization signal. /evidence=ECO:0000255 174..190 0/1 (0%)
Nuclear localization signal. /evidence=ECO:0000255 257..262 0/4 (0%)
C2H2 Zn finger 304..324 CDD:275368 4/19 (21%)
zf-C2H2 304..324 CDD:306579 4/19 (21%)
zf-H2C2_2 316..341 CDD:316026 2/24 (8%)
C2H2 Zn finger 332..352 CDD:275368 2/19 (11%)
zf-H2C2_2 345..369 CDD:316026 6/23 (26%)
SFP1 <354..438 CDD:227516 37/83 (45%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 389..409 CDD:275368 9/19 (47%)
C2H2 Zn finger 417..437 CDD:275368 8/19 (42%)
zf-H2C2_2 430..453 CDD:316026 13/24 (54%)
SFP1 <439..522 CDD:227516 36/93 (39%)
C2H2 Zn finger 445..465 CDD:275368 10/21 (48%)
C2H2 Zn finger 473..493 CDD:275368 7/28 (25%)
C2H2 Zn finger 501..522 CDD:275368 10/20 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 521..556 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.