DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rn and znf384

DIOPT Version :9

Sequence 1:NP_001262343.1 Gene:rn / 40879 FlyBaseID:FBgn0267337 Length:952 Species:Drosophila melanogaster
Sequence 2:XP_012821830.1 Gene:znf384 / 448352 XenbaseID:XB-GENE-979648 Length:564 Species:Xenopus tropicalis


Alignment Length:187 Identity:103/187 - (55%)
Similarity:126/187 - (67%) Gaps:6/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 SGRK-YQCKMCPQIFSSKADLQ----LHTQIHMREAKPYKCTQCSKAFANSSYLSQHTRIHLGIK 543
            ||.| |.|..|.:.|...:.||    :||::|...:|||||..|||.|||||||.||.|||.|.|
 Frog   324 SGVKPYNCSYCQKAFRQLSHLQQHSRIHTKVHSIVSKPYKCPHCSKTFANSSYLHQHLRIHSGAK 388

  Fly   544 PYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKPFKCNSC 608
            ||.|..||:.|.||||||||.|.||||:||||.||||.|||:||||||||.|.|..||||||::|
 Frog   389 PYNCNYCQKAFRQLSHLQQHTRIHTGDRPYKCVHPGCDKAFTQLSNLQSHRRQHNKDKPFKCHNC 453

  Fly   609 YKCFSDEPSLLEHIPKHKESKHLKTHICQYCGKSYTQETYLTKHMQKHAERTDKRPP 665
            ::.::|..:|..|:..| ..||.|.:.|..|.::||.||||.|||:||.....::||
 Frog   454 HRAYTDASALEVHLSTH-TVKHAKVYTCSICSRAYTSETYLMKHMRKHNAPEPQQPP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnNP_001262343.1 C2H2 Zn finger 490..510 CDD:275368 7/23 (30%)
C2H2 Zn finger 519..539 CDD:275368 14/19 (74%)
zf-H2C2_2 531..556 CDD:290200 15/24 (63%)
zf-C2H2 545..567 CDD:278523 14/21 (67%)
C2H2 Zn finger 547..567 CDD:275368 13/19 (68%)
zf-C2H2_8 550..630 CDD:292531 48/79 (61%)
zf-H2C2_2 559..586 CDD:290200 21/26 (81%)
C2H2 Zn finger 575..597 CDD:275368 17/21 (81%)
C2H2 Zn finger 605..625 CDD:275368 5/19 (26%)
C2H2 Zn finger 636..656 CDD:275368 11/19 (58%)
znf384XP_012821830.1 C2H2 Zn finger 214..234 CDD:275368
COG5048 <241..453 CDD:227381 80/128 (63%)
C2H2 Zn finger 242..262 CDD:275368
C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 303..323 CDD:275368
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
C2H2 Zn finger 364..384 CDD:275368 14/19 (74%)
C2H2 Zn finger 392..412 CDD:275368 13/19 (68%)
C2H2 Zn finger 420..442 CDD:275368 17/21 (81%)
C2H2 Zn finger 450..470 CDD:275368 5/19 (26%)
C2H2 Zn finger 480..500 CDD:275368 11/19 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12078
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.