DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rn and trem

DIOPT Version :9

Sequence 1:NP_001262343.1 Gene:rn / 40879 FlyBaseID:FBgn0267337 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:181 Identity:59/181 - (32%)
Similarity:88/181 - (48%) Gaps:16/181 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 SGRK---YQCKMCPQI--FSSKADLQLHTQIHMREAKPYKCTQCSKAFANSSYLSQHTRIHLGIK 543
            ||||   |. |..|::  |..|...:...::     ..|.|..|...:...:.|::|.:.|.|:|
  Fly   240 SGRKPVAYH-KNSPKVETFKKKVGRKPRNKL-----STYICDVCGNIYPTQARLTEHMKFHSGVK 298

  Fly   544 PYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKPFKCNSC 608
            |:.||||.|.|.|...|.:|:.||||::||||.:  |..||:..|....|.|.|..::|:.|:.|
  Fly   299 PHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNY--CPAAFADRSTKTKHHRIHTKERPYVCDVC 361

  Fly   609 YKCFSDEPSLLEHIPKHKESKHLKTHICQYCGKSYTQETYLTKHMQKHAER 659
            .:.|:...:|..|...|...   |.|:|..|||.:.:...|..|.:.|..|
  Fly   362 SRTFTYSDNLKFHKMIHTGE---KPHVCDLCGKGFVKAYKLRLHRETHNRR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnNP_001262343.1 C2H2 Zn finger 490..510 CDD:275368 4/21 (19%)
C2H2 Zn finger 519..539 CDD:275368 4/19 (21%)
zf-H2C2_2 531..556 CDD:290200 12/24 (50%)
zf-C2H2 545..567 CDD:278523 9/21 (43%)
C2H2 Zn finger 547..567 CDD:275368 9/19 (47%)
zf-C2H2_8 550..630 CDD:292531 28/79 (35%)
zf-H2C2_2 559..586 CDD:290200 13/26 (50%)
C2H2 Zn finger 575..597 CDD:275368 7/21 (33%)
C2H2 Zn finger 605..625 CDD:275368 5/19 (26%)
C2H2 Zn finger 636..656 CDD:275368 6/19 (32%)
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 50/156 (32%)
C2H2 Zn finger 274..294 CDD:275368 4/19 (21%)
zf-H2C2_2 287..311 CDD:290200 12/23 (52%)
C2H2 Zn finger 302..322 CDD:275368 9/19 (47%)
zf-H2C2_2 315..338 CDD:290200 12/24 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/21 (33%)
zf-H2C2_2 345..367 CDD:290200 7/21 (33%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 9/26 (35%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.