DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rn and CG12605

DIOPT Version :9

Sequence 1:NP_001262343.1 Gene:rn / 40879 FlyBaseID:FBgn0267337 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster


Alignment Length:545 Identity:120/545 - (22%)
Similarity:194/545 - (35%) Gaps:173/545 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 WSTGNNNEVVSHSSNGHTNNHPTTPPTPPNEASATQATSVSAINLNQAQPASQTRSNFG------ 225
            ||.. .:.|..:||.........|..:|     ||.|..||| :::..:|..:..:..|      
  Fly   127 WSAA-QSLVQMNSSKQEKQRRAGTTGSP-----ATVAAPVSA-SVSLRRPVGRAPAEDGKVIFYA 184

  Fly   226 --SSIKSPPSEPDAVTAATCKSQENNSGQNPTPNSLSDHNPAHNLNSNSTAAAV----------A 278
              :|....|.:|:.|  |..:.:|.:..:........|......|.:.:.||::          |
  Fly   185 PPASASGSPRQPEPV--ALKRERERDKEREREKERERDRMREQQLVAATAAASIYRGRSVEETEA 247

  Fly   279 AAAAAAAAANMP-------------------------IGGVQGQNPTQGLVHWMSAVMAEHMTGQ 318
            |....:.:.::|                         |.........|..:.::.:...:.|.|.
  Fly   248 AHDLLSLSQSLPPLIPPCVVTIMKQEQEQLRSPEIQEISNSASSRSPQSTIRFIGSSSYDLMGGS 312

  Fly   319 THHDPGAVGMHYMWNGNVDHAKDI---------SDYNLW-PPTPRSHQHASEHHPMSLKQEYEAK 373
            :.   ||.....:...|.||:.|:         |....| .|.|:.:|..:....|.|       
  Fly   313 SE---GANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMCL------- 367

  Fly   374 MNDHHHNNLQKGHFLDDNRLEHHAVTGQGGLGLGASNGVGGGGGGASVVGNSSLGASSHHAVAAA 438
                   |:..|.                                                    
  Fly   368 -------NMLDGR---------------------------------------------------- 373

  Fly   439 HHHNQAVAAASAAALL-------VVPQP----INASKMGGPGGV----SSVAGGHATGGG----S 484
                  ..|:.|||:.       :.|:|    .|||..|||...    .:.:.||::.|.    :
  Fly   374 ------TKASKAAAVTKQDRQEPMQPRPKSAQSNASSGGGPPSEPPENPAASLGHSSSGNGENYA 432

  Fly   485 GRK---YQCKMCPQIFSSKADLQLHTQIH----MREAKPYKCTQCSKAFANSSYLSQHTRIHLGI 542
            .||   |:|..|.:.:::.::|..|.|.|    .:.||  ||..|.||:.:...|:.|...|.  
  Fly   433 KRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAK--KCNTCGKAYVSMPALAMHLLTHK-- 493

  Fly   543 KPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKPFKCNS 607
            ..:.|:||.:.|::...||.|:|:|||:|||.|.|  |.|||:..|||::|.:.|..||.|||:.
  Fly   494 LSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVH--CGKAFADRSNLRAHMQTHSGDKNFKCHR 556

  Fly   608 CYKCFSDEPSLLEHIPKHKESKHLK 632
            |.|.|    :|..::.||.||..|:
  Fly   557 CNKTF----ALKSYLNKHLESACLR 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnNP_001262343.1 C2H2 Zn finger 490..510 CDD:275368 5/19 (26%)
C2H2 Zn finger 519..539 CDD:275368 6/19 (32%)
zf-H2C2_2 531..556 CDD:290200 7/24 (29%)
zf-C2H2 545..567 CDD:278523 8/21 (38%)
C2H2 Zn finger 547..567 CDD:275368 8/19 (42%)
zf-C2H2_8 550..630 CDD:292531 36/79 (46%)
zf-H2C2_2 559..586 CDD:290200 16/26 (62%)
C2H2 Zn finger 575..597 CDD:275368 10/21 (48%)
C2H2 Zn finger 605..625 CDD:275368 5/19 (26%)
C2H2 Zn finger 636..656 CDD:275368
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
COG5048 492..>570 CDD:227381 35/85 (41%)
zf-C2H2 496..518 CDD:278523 8/21 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 15/24 (63%)
zf-C2H2 524..546 CDD:278523 11/23 (48%)
C2H2 Zn finger 526..546 CDD:275368 10/21 (48%)
zf-H2C2_2 538..562 CDD:290200 12/27 (44%)
C2H2 Zn finger 554..571 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.