DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rn and Zfp367

DIOPT Version :9

Sequence 1:NP_001262343.1 Gene:rn / 40879 FlyBaseID:FBgn0267337 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001012051.1 Gene:Zfp367 / 306695 RGDID:1307136 Length:340 Species:Rattus norvegicus


Alignment Length:358 Identity:79/358 - (22%)
Similarity:126/358 - (35%) Gaps:114/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 HNQAVAAASAAALLVVPQPINASKM----GGPGGVSSVAGGHATGGGSGRKYQCKMCPQIFSSKA 501
            ||..::..:|..::....|. |:::    |.|...:|||   |..||...:.         :|..
  Rat    73 HNVTLSPGAAGGVVSAGLPA-ATELPTLRGAPPSSASVA---AVSGGEDEEE---------ASSP 124

  Fly   502 DLQLHTQIHMREAKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRT 566
            | ..|.:..:|..:|...|  .:...|.   .:|:...:     ||.||.|.|.:...||.|.||
  Rat   125 D-SGHLKDGIRRGRPRADT--VRDLINE---GEHSSSRI-----RCNICNRVFPREKSLQAHKRT 178

  Fly   567 HTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKPFKC--NSCYKCFSDEPSLLEHIPKHKESK 629
            |||::||.|.:|.|.|||.|...|::|.|.|..:|||.|  |.|...|                 
  Rat   179 HTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRF----------------- 226

  Fly   630 HLKTHICQYCGKSYTQETYLTKHMQKHAERTDKRPPIVPGSAAAIAAAAAAAAGGSANPANGPPP 694
                             |:..:|..||.....||                            ..|
  Rat   227 -----------------THANRHCPKHPYARLKR----------------------------EEP 246

  Fly   695 PPNPAQHQRNNLGLPPVSIAPSDNGYWPKVSPDSAAAANAMEVMHQQQQQQQQQQQQQQQQQQQQ 759
            ....::||                      |.|:.|||..:....:.::|:....:.:..|:..|
  Rat   247 TDTLSKHQ----------------------STDNKAAAEWLAKYWEMREQRTPTLKGKLVQKADQ 289

  Fly   760 QQQAHHHHPQHGVPPQQHVPPQQQQQQQQQQQH 792
            :||....:.|......:....|::.|:|:::.|
  Rat   290 EQQDPLEYLQSDEEDDEKSGAQRRLQEQRERLH 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnNP_001262343.1 C2H2 Zn finger 490..510 CDD:275368 3/19 (16%)
C2H2 Zn finger 519..539 CDD:275368 3/19 (16%)
zf-H2C2_2 531..556 CDD:290200 7/24 (29%)
zf-C2H2 545..567 CDD:278523 10/21 (48%)
C2H2 Zn finger 547..567 CDD:275368 9/19 (47%)
zf-C2H2_8 550..630 CDD:292531 31/81 (38%)
zf-H2C2_2 559..586 CDD:290200 16/26 (62%)
C2H2 Zn finger 575..597 CDD:275368 10/21 (48%)
C2H2 Zn finger 605..625 CDD:275368 4/21 (19%)
C2H2 Zn finger 636..656 CDD:275368 2/19 (11%)
Zfp367NP_001012051.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..140 13/56 (23%)
COG5048 157..>230 CDD:227381 35/111 (32%)
zf-C2H2 158..179 CDD:278523 10/20 (50%)
C2H2 Zn finger 159..179 CDD:275368 9/19 (47%)
zf-H2C2_2 171..198 CDD:290200 16/26 (62%)
C2H2 Zn finger 187..209 CDD:275368 10/21 (48%)
zf-H2C2_2 202..228 CDD:290200 11/59 (19%)
C2H2 Zn finger 217..256 CDD:275368 13/122 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..317 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.