| Sequence 1: | NP_001262343.1 | Gene: | rn / 40879 | FlyBaseID: | FBgn0267337 | Length: | 952 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_494634.1 | Gene: | sdz-12 / 184388 | WormBaseID: | WBGene00017406 | Length: | 330 | Species: | Caenorhabditis elegans |
| Alignment Length: | 271 | Identity: | 66/271 - (24%) |
|---|---|---|---|
| Similarity: | 103/271 - (38%) | Gaps: | 50/271 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 514 AKPYKCTQCSKAFANSSYLSQHTRIHLGIKP---------YRCEICQRKFTQLSHLQQHIRTHTG 569
Fly 570 DKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKP-FKCN--SCYKCFSDEPSLLEHIPKHKESKHL 631
Fly 632 KTHICQYCGKSYTQETYLTKHMQ-KHAERTDKRPPIVPGSAAAIAAAAAAAAGGSANPANGPPPP 695
Fly 696 PNPAQHQRNNLGLPPV----------SIAPSDNGYWPKVSPDSAAAAN----------------- 733
Fly 734 -----AMEVMH 739 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rn | NP_001262343.1 | C2H2 Zn finger | 490..510 | CDD:275368 | |
| C2H2 Zn finger | 519..539 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 531..556 | CDD:290200 | 9/33 (27%) | ||
| zf-C2H2 | 545..567 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 547..567 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2_8 | 550..630 | CDD:292531 | 24/82 (29%) | ||
| zf-H2C2_2 | 559..586 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 575..597 | CDD:275368 | 7/21 (33%) | ||
| C2H2 Zn finger | 605..625 | CDD:275368 | 4/21 (19%) | ||
| C2H2 Zn finger | 636..656 | CDD:275368 | 5/20 (25%) | ||
| sdz-12 | NP_494634.1 | SFP1 | <25..86 | CDD:227516 | 19/61 (31%) |
| C2H2 Zn finger | 29..48 | CDD:275368 | 7/19 (37%) | ||
| COG5236 | <32..>197 | CDD:227561 | 46/168 (27%) | ||
| C2H2 Zn finger | 65..85 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 93..113 | CDD:275368 | 7/21 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||