DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and TCB1

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_014729.1 Gene:TCB1 / 854253 SGDID:S000005612 Length:1186 Species:Saccharomyces cerevisiae


Alignment Length:247 Identity:56/247 - (22%)
Similarity:105/247 - (42%) Gaps:58/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GDIP-TGMNGRTQAATDPYVKLQLLPDKQH------KVKTRVVRNTRNPVYDEDFTFYGLNMNDL 273
            |::| :|:          ||: ....|..|      ::.:|:|:|.    :..|     :.:.:|
Yeast   871 GELPDSGL----------YVQ-AFFDDNGHPRFVSPRIPSRIVKNG----WSGD-----VIIKEL 915

  Fly   274 QNMSLHFVILSFDRYSRDDVIGEVVCPLTSIEIGDISKEALSISKEIQPRSLKIRAQGRGELLIS 338
            ......|.:.....|:|   :.:.||.:      ::..:.|..:...:|..|.:..:|..:|::.
Yeast   916 DKSITTFRVAKNKNYNR---VEKCVCEV------ELPTQELVKNCYYKPSILHLSGEGSAKLMLQ 971

  Fly   339 LCWQPA-------------AGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVK 390
            :.|.|.             :|.||::...|.||...|:.|.:|||:|.|:  |.:.....||.|.
Yeast   972 ISWFPIDTKQLPANDLITNSGDLTIMSRSAENLIASDLNGYSDPYLKYYI--NNEEDCAYKTKVV 1034

  Fly   391 KRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLEL 442
            |:||:|.:|:.....|      ...|..| |.:.::|||..:.::.||..|:
Yeast  1035 KKTLNPKWNDEGTIQI------NNRLNDV-LRIKVMDWDSTSADDTIGTAEI 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 18/112 (16%)
C2B_Synaptotagmin-4 332..473 CDD:176049 35/124 (28%)
TCB1NP_014729.1 COG5038 1..1182 CDD:227371 56/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X61
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.