DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and AT5G50170

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_199828.1 Gene:AT5G50170 / 835082 AraportID:AT5G50170 Length:1027 Species:Arabidopsis thaliana


Alignment Length:166 Identity:40/166 - (24%)
Similarity:73/166 - (43%) Gaps:47/166 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LMVSIIRCRGLPCKGGSSGTGDIPTGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRNTRNPVYD 260
            |.|.|::.:.||.|                     :.:.||.:   .:||.||||.|:|.:|:::
plant     3 LYVYILQAKDLPAK---------------------ETFAKLHV---GRHKSKTRVARDTSSPIWN 43

  Fly   261 EDFTFYGLNMNDLQNMSLHFVILSFDRYSRDD--------VIGEVVCPLTSI---EIGDISKEAL 314
            |:|.|...::::..:     |::|...:.:.|        :||:|..||||:   |...:.....
plant    44 EEFVFRISDVDEGDD-----VVVSILHHEQQDHQSIVSTGLIGKVRIPLTSVAAEENQTLLPTWF 103

  Fly   315 SISKEIQPRSLKIRAQGRGELLISLC----WQPAAG 346
            .|.|....:.:.|..   |::|:||.    |:..:|
plant   104 VIEKPSDGKFVNIEC---GKILLSLSLQGKWESTSG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 33/136 (24%)
C2B_Synaptotagmin-4 332..473 CDD:176049 6/19 (32%)
AT5G50170NP_199828.1 C2 3..105 CDD:175973 31/130 (24%)
DUF4782 260..406 CDD:374299
C2 540..641 CDD:365917
PH-like 703..816 CDD:388408
DUF4782 864..1001 CDD:374299
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1065
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.