DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and SYTC

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_974729.1 Gene:SYTC / 830301 AraportID:AT5G04220 Length:540 Species:Arabidopsis thaliana


Alignment Length:263 Identity:70/263 - (26%)
Similarity:106/263 - (40%) Gaps:72/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LMVSIIRCRGLPCKGGSSGTGDIPTGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRNTRNPVYD 260
            |.|||:|.|.| .|....||              :||||||.|..:|....||.:.:...||.::
plant   263 LHVSILRARNL-LKKDLLGT--------------SDPYVKLSLTGEKLPAKKTTIKKRNLNPEWN 312

  Fly   261 EDFTFYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEVVCPLTSIEIGDISKEALSISKEIQPRSL 325
            |.|.   |.:.|..:..|...:..:|:....|.:|..:.||..|..|:..:..|.:.|    .|.
plant   313 EHFK---LIVKDPNSQVLQLEVFDWDKVGGHDRLGMQMIPLQKINPGERKEFNLDLIK----NSN 370

  Fly   326 KIRAQG----RGELLISLCWQP-------------------------AAGRLTVVLLKARNLPRM 361
            .:...|    ||.|.:.|.:.|                         .||.|:|.:..|:     
plant   371 VVMDSGDKKKRGRLEVDLRYVPFREESIKRRKESREEKSSEDDDFLSQAGLLSVAVQSAK----- 430

  Fly   362 DVTGL---ADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFAFDI--PAAEGAGASLEGVSL 421
            ||.|.   ::||..:  |:.|:   ||||.:.|:|..|.:||.|.|.:  |..:      |.:.:
plant   431 DVEGKKKHSNPYAVV--LFRGE---KKKTKMLKKTRDPRWNEEFQFTLEEPPVK------ESIRV 484

  Fly   422 ELM 424
            |:|
plant   485 EVM 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 36/125 (29%)
C2B_Synaptotagmin-4 332..473 CDD:176049 32/123 (26%)
SYTCNP_974729.1 DUF456 <7..>30 CDD:398136
COG5038 67..>538 CDD:227371 70/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X61
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.