DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and AT3G59660

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_191525.2 Gene:AT3G59660 / 825135 AraportID:AT3G59660 Length:594 Species:Arabidopsis thaliana


Alignment Length:133 Identity:33/133 - (24%)
Similarity:57/133 - (42%) Gaps:34/133 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 AAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFAF---D 405
            ||..:.|.||.|:||...::.|.:|||.   ::..|..  |:.:.:...:.:|::.|.|.|   :
plant    79 AAYIVKVELLAAKNLIGANLNGTSDPYA---IVNCGSE--KRFSSMVPGSRNPMWGEEFNFPTDE 138

  Fly   406 IPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWH 470
            :||           .:.:.:.|||.:.|:.|:|          |..:|...|....|     .||
plant   139 LPA-----------KINVTIHDWDIIWKSTVLG----------SVTINVEREGQTGP-----VWH 177

  Fly   471 KLN 473
            .|:
plant   178 SLD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034
C2B_Synaptotagmin-4 332..473 CDD:176049 32/131 (24%)
AT3G59660NP_191525.2 C2 83..179 CDD:175973 30/126 (24%)
PH-GRAM_C2-GRAM 240..348 CDD:270039
DUF4782 406..552 CDD:406424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1065
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.